Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139A754

Protein Details
Accession A0A139A754   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPSSDPHASHKKRKRDNEDSNPSGKLHydrophilic
44-64PSQSSRKKSPLDLKSKKRLLSHydrophilic
NLS Segment(s)
PositionSequence
49-73RKKSPLDLKSKKRLLSAIAKRKARA
Subcellular Location(s) nucl 13.5, cyto_nucl 9, mito 4, cyto 3.5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007823  RRP8  
IPR042036  RRP8_N  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF05148  Methyltransf_8  
Amino Acid Sequences MPSSDPHASHKKRKRDNEDSNPSGKLVKTTKSTIDGSIASNSTPSQSSRKKSPLDLKSKKRLLSAIAKRKARASGSQPATNGPEKEISRSYESSPPKDPSRTNVDGVKHTSQPVLPPSLAAAQFRFLNEKLYTTTSDAAWAMFQKDSEDGRAMWESYHRGFRSQVEVWPVNPLDIIIQSLKSEYLKGGGKDLAVVDLGCGEAKLAQELTKGSLPASRGSPAVGKVGENTVKVWSFDLCEDSQGWVTACDIKKVPLLSSSVDVAVFCLSLMGTNYIDFVKEATRLLKTGGTLKIAEVISRFSNASNNTATKHPKSHRDHSDDIPSTNSKSIQSFVSALRRLGLDLAKQDTSNKMFVLFDFIKRSAGGKSTGVIDAPPLKPCVYKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.91
4 0.91
5 0.92
6 0.88
7 0.82
8 0.72
9 0.63
10 0.55
11 0.44
12 0.4
13 0.35
14 0.34
15 0.35
16 0.38
17 0.42
18 0.43
19 0.45
20 0.39
21 0.38
22 0.34
23 0.3
24 0.3
25 0.26
26 0.21
27 0.2
28 0.18
29 0.16
30 0.16
31 0.17
32 0.23
33 0.3
34 0.36
35 0.45
36 0.53
37 0.55
38 0.62
39 0.7
40 0.7
41 0.74
42 0.78
43 0.79
44 0.82
45 0.84
46 0.78
47 0.71
48 0.64
49 0.59
50 0.6
51 0.61
52 0.61
53 0.62
54 0.63
55 0.61
56 0.62
57 0.61
58 0.54
59 0.5
60 0.46
61 0.48
62 0.5
63 0.52
64 0.49
65 0.46
66 0.47
67 0.44
68 0.38
69 0.3
70 0.3
71 0.27
72 0.31
73 0.31
74 0.31
75 0.32
76 0.33
77 0.35
78 0.36
79 0.41
80 0.41
81 0.43
82 0.44
83 0.44
84 0.48
85 0.46
86 0.43
87 0.47
88 0.46
89 0.44
90 0.44
91 0.42
92 0.41
93 0.45
94 0.43
95 0.35
96 0.33
97 0.31
98 0.26
99 0.27
100 0.25
101 0.23
102 0.19
103 0.18
104 0.18
105 0.21
106 0.21
107 0.19
108 0.16
109 0.14
110 0.15
111 0.16
112 0.18
113 0.14
114 0.18
115 0.17
116 0.18
117 0.18
118 0.2
119 0.21
120 0.19
121 0.2
122 0.15
123 0.16
124 0.15
125 0.13
126 0.11
127 0.1
128 0.1
129 0.09
130 0.09
131 0.08
132 0.11
133 0.11
134 0.12
135 0.13
136 0.11
137 0.13
138 0.14
139 0.14
140 0.11
141 0.13
142 0.14
143 0.15
144 0.21
145 0.19
146 0.2
147 0.21
148 0.23
149 0.27
150 0.25
151 0.26
152 0.25
153 0.26
154 0.25
155 0.27
156 0.25
157 0.19
158 0.17
159 0.15
160 0.09
161 0.08
162 0.09
163 0.06
164 0.06
165 0.06
166 0.06
167 0.07
168 0.07
169 0.07
170 0.06
171 0.09
172 0.11
173 0.11
174 0.13
175 0.13
176 0.12
177 0.13
178 0.13
179 0.09
180 0.07
181 0.07
182 0.05
183 0.04
184 0.04
185 0.03
186 0.03
187 0.03
188 0.04
189 0.04
190 0.05
191 0.05
192 0.05
193 0.06
194 0.07
195 0.09
196 0.09
197 0.09
198 0.09
199 0.11
200 0.11
201 0.12
202 0.13
203 0.12
204 0.11
205 0.12
206 0.14
207 0.12
208 0.14
209 0.12
210 0.11
211 0.11
212 0.14
213 0.15
214 0.14
215 0.14
216 0.14
217 0.14
218 0.14
219 0.14
220 0.11
221 0.1
222 0.11
223 0.13
224 0.11
225 0.12
226 0.12
227 0.12
228 0.12
229 0.12
230 0.11
231 0.08
232 0.09
233 0.14
234 0.14
235 0.15
236 0.15
237 0.16
238 0.18
239 0.19
240 0.19
241 0.15
242 0.17
243 0.16
244 0.17
245 0.16
246 0.14
247 0.13
248 0.12
249 0.1
250 0.09
251 0.07
252 0.05
253 0.04
254 0.04
255 0.04
256 0.05
257 0.07
258 0.07
259 0.07
260 0.08
261 0.08
262 0.08
263 0.08
264 0.08
265 0.08
266 0.09
267 0.1
268 0.11
269 0.13
270 0.13
271 0.14
272 0.15
273 0.15
274 0.2
275 0.21
276 0.2
277 0.2
278 0.19
279 0.23
280 0.22
281 0.21
282 0.16
283 0.17
284 0.15
285 0.16
286 0.17
287 0.12
288 0.17
289 0.18
290 0.21
291 0.22
292 0.23
293 0.23
294 0.29
295 0.35
296 0.34
297 0.42
298 0.45
299 0.51
300 0.58
301 0.66
302 0.7
303 0.72
304 0.72
305 0.69
306 0.73
307 0.65
308 0.58
309 0.53
310 0.45
311 0.39
312 0.37
313 0.33
314 0.24
315 0.23
316 0.24
317 0.2
318 0.21
319 0.21
320 0.23
321 0.3
322 0.3
323 0.29
324 0.29
325 0.28
326 0.25
327 0.26
328 0.25
329 0.19
330 0.21
331 0.25
332 0.25
333 0.25
334 0.27
335 0.3
336 0.31
337 0.29
338 0.25
339 0.23
340 0.22
341 0.22
342 0.28
343 0.24
344 0.25
345 0.29
346 0.29
347 0.29
348 0.29
349 0.3
350 0.25
351 0.25
352 0.25
353 0.2
354 0.21
355 0.23
356 0.23
357 0.22
358 0.19
359 0.2
360 0.24
361 0.24
362 0.26
363 0.25
364 0.25
365 0.31