Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AF44

Protein Details
Accession A0A139AF44    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
46-75SHKITWIRSRRQPPGRQTRQRGVRHCDKVFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 8, mito 7, cyto 4.5, cyto_nucl 4.5, nucl 3.5, pero 3
Family & Domain DBs
Amino Acid Sequences MSTYSNFEFKTTSWLTSALFVPQAGALLEATTVGFKSFQFSAVQISHKITWIRSRRQPPGRQTRQRGVRHCDKVFQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.22
4 0.22
5 0.15
6 0.14
7 0.12
8 0.11
9 0.1
10 0.1
11 0.07
12 0.07
13 0.05
14 0.05
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.07
24 0.07
25 0.08
26 0.08
27 0.09
28 0.12
29 0.13
30 0.15
31 0.14
32 0.16
33 0.15
34 0.18
35 0.19
36 0.17
37 0.24
38 0.31
39 0.37
40 0.44
41 0.52
42 0.59
43 0.68
44 0.75
45 0.76
46 0.8
47 0.83
48 0.85
49 0.85
50 0.85
51 0.85
52 0.86
53 0.84
54 0.82
55 0.81
56 0.81
57 0.75