Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AI28

Protein Details
Accession A0A139AI28    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
145-172ICNPPESRKAKGRVKKWRRRIWVETIWEHydrophilic
NLS Segment(s)
PositionSequence
152-164RKAKGRVKKWRRR
Subcellular Location(s) nucl 14.5, cyto_nucl 13, cyto 10.5
Family & Domain DBs
Amino Acid Sequences MDLSDDYEYLDACSSDGSDFQFLDEFTFDIESFGSSILVPDECQERALTAFDVFEEEALLLFEDIEATNRKEEEESDPPLRIDRTSTFSTGVDGLVRQRAPDITENDLDPISRPNARSVGKLRFGVASNKSRVWNENRFSTCCRICNPPESRKAKGRVKKWRRRIWVETIWEQDVDKGVIGRTNGYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.11
5 0.11
6 0.11
7 0.12
8 0.13
9 0.12
10 0.13
11 0.12
12 0.1
13 0.09
14 0.11
15 0.1
16 0.09
17 0.09
18 0.08
19 0.08
20 0.08
21 0.07
22 0.06
23 0.06
24 0.07
25 0.07
26 0.07
27 0.08
28 0.1
29 0.1
30 0.11
31 0.11
32 0.1
33 0.11
34 0.12
35 0.12
36 0.09
37 0.09
38 0.08
39 0.1
40 0.09
41 0.08
42 0.07
43 0.06
44 0.05
45 0.05
46 0.06
47 0.04
48 0.04
49 0.03
50 0.04
51 0.04
52 0.06
53 0.08
54 0.08
55 0.1
56 0.1
57 0.11
58 0.11
59 0.12
60 0.17
61 0.19
62 0.23
63 0.24
64 0.25
65 0.24
66 0.25
67 0.24
68 0.18
69 0.16
70 0.13
71 0.17
72 0.18
73 0.19
74 0.19
75 0.18
76 0.19
77 0.16
78 0.14
79 0.09
80 0.08
81 0.07
82 0.09
83 0.09
84 0.08
85 0.08
86 0.08
87 0.1
88 0.15
89 0.17
90 0.17
91 0.18
92 0.18
93 0.19
94 0.18
95 0.16
96 0.12
97 0.11
98 0.1
99 0.12
100 0.12
101 0.14
102 0.2
103 0.21
104 0.25
105 0.28
106 0.33
107 0.35
108 0.35
109 0.33
110 0.3
111 0.3
112 0.32
113 0.33
114 0.32
115 0.31
116 0.33
117 0.35
118 0.34
119 0.38
120 0.39
121 0.42
122 0.39
123 0.45
124 0.46
125 0.47
126 0.5
127 0.52
128 0.48
129 0.43
130 0.42
131 0.41
132 0.4
133 0.47
134 0.51
135 0.52
136 0.58
137 0.61
138 0.64
139 0.65
140 0.71
141 0.71
142 0.72
143 0.74
144 0.75
145 0.81
146 0.85
147 0.88
148 0.89
149 0.89
150 0.9
151 0.87
152 0.85
153 0.83
154 0.8
155 0.76
156 0.7
157 0.62
158 0.53
159 0.46
160 0.38
161 0.31
162 0.24
163 0.18
164 0.14
165 0.13
166 0.15
167 0.16