Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AH52

Protein Details
Accession A0A139AH52    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
79-104LSHARNARPRPLRHRRCQAPIPSRPAHydrophilic
NLS Segment(s)
PositionSequence
60-93ERGSHMRARRRPTPGQGSSLSHARNARPRPLRHR
Subcellular Location(s) mito 12, nucl 7, extr 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MLPPLPPKLILPLPHTILTPSCSPHATQTRTACAIAVSTSTPAVVCRGTPAPAHLDRERERGSHMRARRRPTPGQGSSLSHARNARPRPLRHRRCQAPIPSRPANPSTWLQPWAFRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.3
4 0.27
5 0.25
6 0.23
7 0.2
8 0.18
9 0.18
10 0.19
11 0.26
12 0.33
13 0.34
14 0.38
15 0.4
16 0.42
17 0.43
18 0.42
19 0.34
20 0.26
21 0.22
22 0.15
23 0.13
24 0.09
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.08
31 0.07
32 0.06
33 0.08
34 0.09
35 0.11
36 0.11
37 0.12
38 0.16
39 0.18
40 0.23
41 0.21
42 0.26
43 0.27
44 0.32
45 0.32
46 0.27
47 0.29
48 0.29
49 0.32
50 0.34
51 0.38
52 0.43
53 0.48
54 0.53
55 0.57
56 0.59
57 0.59
58 0.6
59 0.63
60 0.56
61 0.54
62 0.51
63 0.47
64 0.42
65 0.42
66 0.35
67 0.29
68 0.29
69 0.28
70 0.34
71 0.35
72 0.42
73 0.46
74 0.53
75 0.6
76 0.69
77 0.76
78 0.77
79 0.84
80 0.83
81 0.82
82 0.84
83 0.83
84 0.82
85 0.8
86 0.78
87 0.74
88 0.69
89 0.65
90 0.6
91 0.52
92 0.46
93 0.41
94 0.39
95 0.37
96 0.38
97 0.34