Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AV61

Protein Details
Accession A0A139AV61    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
29-53CLNPSFNKVKIKRCHPSRQPANLAPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14cyto_nucl 14, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR019956  Ubiquitin_dom  
IPR000433  Znf_ZZ  
IPR043145  Znf_ZZ_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PF00569  ZZ  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
PS50135  ZF_ZZ_2  
CDD cd17039  Ubl_ubiquitin_like  
cd02338  ZZ_PCMF_like  
Amino Acid Sequences MRFAENVAETPSELALYAENNLAVASSTCLNPSFNKVKIKRCHPSRQPANLAPTHTVDSAPNSPSTPRIGEHDRTPIEVHVKTLTGKTFTLSATNCDTVRHLKAQIKTLQDIPISQQRLIFSGKQVEDDKTLLEYGVTDGTVVHMALVLRLGMCMPSSGRVEFDALPVDPYAVSHPGVQCDSCGMIGFIGPRYKCLQCPKYDLCTTCHDSRHTHNPDHFLVKIPDSNHIPASFASLFTPGNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.08
4 0.09
5 0.09
6 0.09
7 0.08
8 0.08
9 0.08
10 0.07
11 0.07
12 0.07
13 0.08
14 0.09
15 0.1
16 0.11
17 0.13
18 0.14
19 0.21
20 0.25
21 0.3
22 0.4
23 0.45
24 0.54
25 0.61
26 0.69
27 0.72
28 0.75
29 0.81
30 0.8
31 0.85
32 0.85
33 0.86
34 0.84
35 0.79
36 0.77
37 0.69
38 0.62
39 0.53
40 0.46
41 0.39
42 0.31
43 0.26
44 0.2
45 0.21
46 0.22
47 0.21
48 0.19
49 0.17
50 0.18
51 0.19
52 0.21
53 0.18
54 0.16
55 0.2
56 0.25
57 0.27
58 0.29
59 0.35
60 0.33
61 0.33
62 0.33
63 0.29
64 0.28
65 0.26
66 0.24
67 0.17
68 0.17
69 0.17
70 0.18
71 0.17
72 0.14
73 0.14
74 0.13
75 0.14
76 0.13
77 0.16
78 0.14
79 0.16
80 0.17
81 0.19
82 0.18
83 0.17
84 0.18
85 0.18
86 0.2
87 0.2
88 0.21
89 0.24
90 0.27
91 0.32
92 0.35
93 0.34
94 0.33
95 0.33
96 0.31
97 0.26
98 0.24
99 0.21
100 0.22
101 0.21
102 0.2
103 0.2
104 0.17
105 0.19
106 0.21
107 0.18
108 0.13
109 0.17
110 0.16
111 0.18
112 0.19
113 0.18
114 0.18
115 0.17
116 0.16
117 0.12
118 0.12
119 0.09
120 0.07
121 0.06
122 0.05
123 0.05
124 0.05
125 0.04
126 0.04
127 0.05
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.05
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.03
140 0.04
141 0.04
142 0.04
143 0.07
144 0.09
145 0.09
146 0.1
147 0.11
148 0.13
149 0.13
150 0.13
151 0.13
152 0.11
153 0.12
154 0.11
155 0.1
156 0.08
157 0.08
158 0.09
159 0.09
160 0.1
161 0.11
162 0.12
163 0.14
164 0.16
165 0.15
166 0.13
167 0.13
168 0.13
169 0.1
170 0.1
171 0.08
172 0.07
173 0.07
174 0.09
175 0.11
176 0.15
177 0.15
178 0.17
179 0.21
180 0.23
181 0.29
182 0.38
183 0.42
184 0.41
185 0.5
186 0.53
187 0.57
188 0.61
189 0.57
190 0.5
191 0.51
192 0.53
193 0.5
194 0.49
195 0.44
196 0.43
197 0.48
198 0.55
199 0.54
200 0.55
201 0.54
202 0.55
203 0.56
204 0.56
205 0.5
206 0.45
207 0.41
208 0.37
209 0.37
210 0.32
211 0.35
212 0.34
213 0.36
214 0.34
215 0.32
216 0.3
217 0.26
218 0.31
219 0.25
220 0.21
221 0.19
222 0.18