Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AQJ9

Protein Details
Accession A0A139AQJ9    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-51MSRHRPDRKRLLHKARPVPESLPEPAPASSRRKKRKSAHKRSKNNVDPSSLHydrophilic
NLS Segment(s)
PositionSequence
4-43HRPDRKRLLHKARPVPESLPEPAPASSRRKKRKSAHKRSK
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR003959  ATPase_AAA_core  
IPR000641  CbxX/CfxQ  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
Pfam View protein in Pfam  
PF00004  AAA  
CDD cd00009  AAA  
Amino Acid Sequences MSRHRPDRKRLLHKARPVPESLPEPAPASSRRKKRKSAHKRSKNNVDPSSLETEGSHPRDLLPDEGPVSNPQLEEYELVEEWRKRTDVNAGRQSETPPPEPEEPPASPPPLPEPEEAPPPPADPHLTSILHLREAEIRQLKDVVFSLQLRVKQLEPIPVDQAETPGEIVSMDAEVADLFKDIIGMGKLKLAFQDFYSSAKLNVARRKLGIQSGANSGALGGLGSRPHMCFVGNPGTGKTKMARLVKTMMQKVDLLPPNGKFLEVSRDDLVGGFVGQTEARMKAAFEMARDGVLFVDEAYRLTPTSAGSHSSSDYGRIALDAILTQMTAATNSITFIFAGYPTNMTHFLTANPGLRSRIPYTFQFPDYSCPELAAIFERTCVLAGFDLAPDVDRTWLAEEFGRFSEERRRSANGRLVEVLFNKCRVALDARLSAWARKVGDGMTWERRLLQTIERGDVEEGMKRVEIEMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.89
3 0.82
4 0.76
5 0.68
6 0.63
7 0.58
8 0.52
9 0.44
10 0.38
11 0.35
12 0.32
13 0.33
14 0.33
15 0.38
16 0.42
17 0.5
18 0.6
19 0.67
20 0.76
21 0.82
22 0.87
23 0.89
24 0.91
25 0.92
26 0.92
27 0.94
28 0.95
29 0.96
30 0.94
31 0.92
32 0.85
33 0.79
34 0.71
35 0.65
36 0.61
37 0.5
38 0.4
39 0.31
40 0.3
41 0.34
42 0.34
43 0.3
44 0.24
45 0.24
46 0.27
47 0.29
48 0.28
49 0.21
50 0.2
51 0.21
52 0.22
53 0.23
54 0.21
55 0.22
56 0.2
57 0.19
58 0.17
59 0.16
60 0.16
61 0.16
62 0.15
63 0.15
64 0.13
65 0.14
66 0.19
67 0.2
68 0.2
69 0.23
70 0.22
71 0.19
72 0.22
73 0.31
74 0.34
75 0.42
76 0.5
77 0.5
78 0.51
79 0.53
80 0.54
81 0.5
82 0.47
83 0.4
84 0.34
85 0.35
86 0.37
87 0.37
88 0.38
89 0.37
90 0.33
91 0.35
92 0.36
93 0.34
94 0.3
95 0.3
96 0.32
97 0.31
98 0.33
99 0.28
100 0.29
101 0.29
102 0.36
103 0.35
104 0.32
105 0.27
106 0.25
107 0.25
108 0.23
109 0.23
110 0.17
111 0.2
112 0.23
113 0.22
114 0.21
115 0.25
116 0.25
117 0.24
118 0.22
119 0.2
120 0.2
121 0.21
122 0.28
123 0.28
124 0.27
125 0.26
126 0.28
127 0.27
128 0.23
129 0.23
130 0.17
131 0.15
132 0.15
133 0.17
134 0.18
135 0.2
136 0.21
137 0.22
138 0.21
139 0.22
140 0.24
141 0.27
142 0.27
143 0.27
144 0.27
145 0.25
146 0.26
147 0.21
148 0.2
149 0.14
150 0.12
151 0.1
152 0.08
153 0.07
154 0.06
155 0.06
156 0.05
157 0.04
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.04
170 0.05
171 0.06
172 0.06
173 0.08
174 0.09
175 0.09
176 0.1
177 0.11
178 0.11
179 0.1
180 0.14
181 0.13
182 0.15
183 0.17
184 0.16
185 0.14
186 0.17
187 0.2
188 0.21
189 0.26
190 0.28
191 0.27
192 0.28
193 0.3
194 0.29
195 0.28
196 0.27
197 0.23
198 0.22
199 0.23
200 0.22
201 0.2
202 0.17
203 0.15
204 0.1
205 0.08
206 0.06
207 0.03
208 0.03
209 0.03
210 0.04
211 0.05
212 0.05
213 0.06
214 0.07
215 0.07
216 0.06
217 0.11
218 0.17
219 0.17
220 0.17
221 0.18
222 0.2
223 0.21
224 0.21
225 0.18
226 0.14
227 0.2
228 0.24
229 0.24
230 0.24
231 0.27
232 0.3
233 0.35
234 0.35
235 0.29
236 0.26
237 0.25
238 0.24
239 0.28
240 0.27
241 0.23
242 0.22
243 0.22
244 0.24
245 0.24
246 0.23
247 0.15
248 0.13
249 0.18
250 0.17
251 0.2
252 0.17
253 0.18
254 0.18
255 0.17
256 0.17
257 0.09
258 0.08
259 0.05
260 0.04
261 0.04
262 0.04
263 0.04
264 0.05
265 0.06
266 0.06
267 0.07
268 0.07
269 0.07
270 0.11
271 0.11
272 0.1
273 0.13
274 0.12
275 0.13
276 0.13
277 0.12
278 0.08
279 0.07
280 0.07
281 0.04
282 0.05
283 0.05
284 0.05
285 0.05
286 0.06
287 0.06
288 0.06
289 0.07
290 0.07
291 0.09
292 0.1
293 0.13
294 0.13
295 0.15
296 0.15
297 0.16
298 0.16
299 0.15
300 0.14
301 0.12
302 0.1
303 0.09
304 0.09
305 0.07
306 0.07
307 0.05
308 0.06
309 0.05
310 0.05
311 0.05
312 0.04
313 0.04
314 0.04
315 0.05
316 0.05
317 0.05
318 0.05
319 0.06
320 0.06
321 0.06
322 0.06
323 0.06
324 0.06
325 0.08
326 0.08
327 0.09
328 0.09
329 0.12
330 0.13
331 0.13
332 0.13
333 0.12
334 0.12
335 0.15
336 0.18
337 0.2
338 0.2
339 0.21
340 0.22
341 0.23
342 0.27
343 0.27
344 0.28
345 0.28
346 0.3
347 0.35
348 0.37
349 0.37
350 0.35
351 0.32
352 0.33
353 0.34
354 0.34
355 0.27
356 0.23
357 0.22
358 0.19
359 0.19
360 0.17
361 0.16
362 0.13
363 0.13
364 0.13
365 0.13
366 0.13
367 0.13
368 0.1
369 0.07
370 0.08
371 0.08
372 0.08
373 0.08
374 0.08
375 0.08
376 0.08
377 0.08
378 0.08
379 0.08
380 0.09
381 0.11
382 0.12
383 0.12
384 0.15
385 0.15
386 0.17
387 0.18
388 0.2
389 0.17
390 0.19
391 0.28
392 0.31
393 0.34
394 0.35
395 0.4
396 0.41
397 0.49
398 0.55
399 0.49
400 0.47
401 0.46
402 0.44
403 0.43
404 0.43
405 0.41
406 0.36
407 0.33
408 0.29
409 0.27
410 0.25
411 0.25
412 0.26
413 0.25
414 0.29
415 0.32
416 0.32
417 0.37
418 0.38
419 0.37
420 0.35
421 0.34
422 0.29
423 0.26
424 0.27
425 0.22
426 0.23
427 0.26
428 0.29
429 0.33
430 0.34
431 0.33
432 0.34
433 0.34
434 0.35
435 0.33
436 0.33
437 0.32
438 0.34
439 0.38
440 0.36
441 0.37
442 0.34
443 0.34
444 0.3
445 0.26
446 0.23
447 0.21
448 0.2
449 0.19