Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AUK3

Protein Details
Accession A0A139AUK3   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
90-110AEKKEEKPKKEEKKEEEEDDDAcidic
NLS Segment(s)
PositionSequence
90-103AEKKEEKPKKEEKK
Subcellular Location(s) cyto 15, cyto_nucl 9.833, cyto_mito 9.833, nucl 3.5, mito 3.5, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038716  P1/P2_N_sf  
IPR027534  Ribosomal_L12/P1/P2  
IPR044076  Ribosomal_P2  
IPR001859  T.cruzi_P2-like  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002182  P:cytoplasmic translational elongation  
Pfam View protein in Pfam  
PF00428  Ribosomal_60s  
CDD cd05833  Ribosomal_P2  
Amino Acid Sequences MKHVAAYLLLVLGGNASPSASDIESVLSAVGIESDADKLKTLIKELKGKNLEELIAAGASKLSAIPTAGSAPAAAAPAAAAPAAAGPAAAEKKEEKPKKEEKKEEEEDDDMGFGLFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.07
7 0.07
8 0.07
9 0.07
10 0.08
11 0.08
12 0.08
13 0.07
14 0.05
15 0.05
16 0.04
17 0.04
18 0.03
19 0.03
20 0.04
21 0.05
22 0.06
23 0.07
24 0.07
25 0.07
26 0.11
27 0.12
28 0.14
29 0.18
30 0.22
31 0.31
32 0.32
33 0.4
34 0.4
35 0.4
36 0.38
37 0.34
38 0.29
39 0.21
40 0.2
41 0.11
42 0.08
43 0.07
44 0.05
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.03
64 0.03
65 0.04
66 0.03
67 0.03
68 0.02
69 0.02
70 0.03
71 0.03
72 0.02
73 0.02
74 0.06
75 0.07
76 0.07
77 0.09
78 0.11
79 0.19
80 0.3
81 0.37
82 0.39
83 0.47
84 0.58
85 0.68
86 0.76
87 0.79
88 0.76
89 0.8
90 0.83
91 0.8
92 0.75
93 0.65
94 0.56
95 0.46
96 0.38
97 0.28