Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139A5S6

Protein Details
Accession A0A139A5S6   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
82-124PLDLRAKKTRAQRRRLTRFEESRKTERQIKKERHFGQRKYAVKBasic
NLS Segment(s)
PositionSequence
86-121RAKKTRAQRRRLTRFEESRKTERQIKKERHFGQRKY
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MLQAKLKTYELRNKTKADLTKQLDELKQELSSLRVQKVAGGATAKLSKIHTVRKNVARVLTVISQTQREQLRIFYQGKKYLPLDLRAKKTRAQRRRLTRFEESRKTERQIKKERHFGQRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.61
4 0.58
5 0.6
6 0.56
7 0.56
8 0.57
9 0.57
10 0.52
11 0.47
12 0.41
13 0.33
14 0.27
15 0.22
16 0.19
17 0.16
18 0.2
19 0.21
20 0.21
21 0.21
22 0.2
23 0.21
24 0.22
25 0.2
26 0.16
27 0.13
28 0.12
29 0.13
30 0.14
31 0.13
32 0.13
33 0.13
34 0.16
35 0.18
36 0.27
37 0.3
38 0.35
39 0.42
40 0.47
41 0.5
42 0.48
43 0.46
44 0.37
45 0.32
46 0.29
47 0.24
48 0.18
49 0.15
50 0.14
51 0.14
52 0.14
53 0.18
54 0.16
55 0.16
56 0.16
57 0.16
58 0.18
59 0.22
60 0.26
61 0.26
62 0.29
63 0.34
64 0.34
65 0.36
66 0.34
67 0.35
68 0.34
69 0.36
70 0.4
71 0.42
72 0.49
73 0.51
74 0.53
75 0.51
76 0.59
77 0.63
78 0.64
79 0.66
80 0.68
81 0.74
82 0.82
83 0.84
84 0.82
85 0.81
86 0.82
87 0.82
88 0.82
89 0.78
90 0.75
91 0.74
92 0.72
93 0.72
94 0.7
95 0.7
96 0.71
97 0.75
98 0.77
99 0.82
100 0.84
101 0.85
102 0.87
103 0.82
104 0.82
105 0.81