Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AKP9

Protein Details
Accession A0A139AKP9    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
386-408GLEKPEGSSNSRREKRRKRRKNSBasic
NLS Segment(s)
PositionSequence
396-408SRREKRRKRRKNS
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005636  DTW  
Gene Ontology GO:0016432  F:tRNA-uridine aminocarboxypropyltransferase activity  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF03942  DTW  
Amino Acid Sequences MTAPSNPLPFASLSISPFSNTVDSALQHRGNCPRCNGSCPTFCYDCLIPVVNVERTPRVRLPVKIKIFVHFNERRGKATGLHAAVLAPDDAEVIVVEKDSSGRYIVPVEVEEQCNPETTFLLFPGSDAVTFSSLSVHPPTADSSRTTSPASPSTSSEHTLIFIDGTWPQAKSLLAESPFFGKFRKLTLAGDHRTLFWRHHDFGDTYLSTIECIYWACREWWEAHLGVYGETEWQPSAIPDTELGIEGSLSHSEPLSEKQGDHDQGVAGSSNATDRKHETNKGYSSHRTTETSELDEALGTTGTSEDDEFLLQLGDYESKAWASEVKQDQPRPPPLSPLRPLDELLFYFRHQYLLVRDRYSAMMDGRETTHGHRLAILKCAHVMVPGLEKPEGSSNSRREKRRKRRKNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.21
4 0.21
5 0.21
6 0.18
7 0.16
8 0.16
9 0.15
10 0.16
11 0.19
12 0.26
13 0.28
14 0.28
15 0.33
16 0.4
17 0.45
18 0.49
19 0.51
20 0.53
21 0.51
22 0.56
23 0.58
24 0.55
25 0.54
26 0.55
27 0.56
28 0.49
29 0.46
30 0.46
31 0.4
32 0.34
33 0.31
34 0.28
35 0.21
36 0.22
37 0.26
38 0.23
39 0.24
40 0.25
41 0.29
42 0.29
43 0.35
44 0.35
45 0.38
46 0.42
47 0.47
48 0.53
49 0.56
50 0.6
51 0.61
52 0.59
53 0.56
54 0.56
55 0.5
56 0.51
57 0.47
58 0.47
59 0.49
60 0.49
61 0.48
62 0.46
63 0.46
64 0.39
65 0.39
66 0.41
67 0.33
68 0.32
69 0.29
70 0.25
71 0.24
72 0.21
73 0.15
74 0.07
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.07
88 0.07
89 0.07
90 0.08
91 0.1
92 0.11
93 0.11
94 0.11
95 0.13
96 0.15
97 0.16
98 0.16
99 0.17
100 0.16
101 0.18
102 0.17
103 0.15
104 0.13
105 0.12
106 0.13
107 0.11
108 0.12
109 0.1
110 0.1
111 0.11
112 0.1
113 0.09
114 0.09
115 0.09
116 0.08
117 0.09
118 0.09
119 0.09
120 0.09
121 0.11
122 0.12
123 0.11
124 0.1
125 0.11
126 0.14
127 0.14
128 0.15
129 0.15
130 0.18
131 0.19
132 0.21
133 0.22
134 0.21
135 0.22
136 0.25
137 0.26
138 0.24
139 0.24
140 0.25
141 0.26
142 0.26
143 0.24
144 0.2
145 0.17
146 0.17
147 0.15
148 0.11
149 0.08
150 0.08
151 0.07
152 0.09
153 0.09
154 0.09
155 0.08
156 0.1
157 0.1
158 0.1
159 0.11
160 0.13
161 0.13
162 0.13
163 0.14
164 0.15
165 0.16
166 0.16
167 0.14
168 0.13
169 0.13
170 0.14
171 0.18
172 0.16
173 0.16
174 0.23
175 0.31
176 0.3
177 0.32
178 0.31
179 0.28
180 0.29
181 0.29
182 0.23
183 0.21
184 0.24
185 0.23
186 0.23
187 0.25
188 0.22
189 0.23
190 0.26
191 0.2
192 0.15
193 0.14
194 0.13
195 0.11
196 0.1
197 0.08
198 0.04
199 0.05
200 0.05
201 0.06
202 0.07
203 0.07
204 0.08
205 0.09
206 0.1
207 0.12
208 0.13
209 0.13
210 0.12
211 0.13
212 0.12
213 0.11
214 0.1
215 0.08
216 0.07
217 0.07
218 0.07
219 0.06
220 0.06
221 0.06
222 0.05
223 0.08
224 0.07
225 0.07
226 0.07
227 0.08
228 0.09
229 0.09
230 0.09
231 0.06
232 0.06
233 0.05
234 0.06
235 0.06
236 0.05
237 0.05
238 0.05
239 0.05
240 0.07
241 0.09
242 0.13
243 0.14
244 0.13
245 0.17
246 0.23
247 0.24
248 0.23
249 0.22
250 0.17
251 0.16
252 0.17
253 0.13
254 0.07
255 0.06
256 0.06
257 0.08
258 0.1
259 0.1
260 0.12
261 0.15
262 0.23
263 0.28
264 0.34
265 0.36
266 0.42
267 0.46
268 0.48
269 0.5
270 0.48
271 0.48
272 0.47
273 0.45
274 0.4
275 0.39
276 0.41
277 0.38
278 0.35
279 0.3
280 0.25
281 0.22
282 0.2
283 0.17
284 0.11
285 0.09
286 0.05
287 0.05
288 0.05
289 0.05
290 0.05
291 0.05
292 0.05
293 0.06
294 0.06
295 0.06
296 0.06
297 0.06
298 0.05
299 0.05
300 0.06
301 0.06
302 0.06
303 0.07
304 0.07
305 0.07
306 0.08
307 0.08
308 0.1
309 0.11
310 0.2
311 0.24
312 0.32
313 0.39
314 0.44
315 0.5
316 0.55
317 0.63
318 0.6
319 0.55
320 0.57
321 0.58
322 0.62
323 0.62
324 0.6
325 0.56
326 0.51
327 0.52
328 0.44
329 0.4
330 0.32
331 0.3
332 0.26
333 0.21
334 0.24
335 0.23
336 0.22
337 0.19
338 0.21
339 0.25
340 0.32
341 0.37
342 0.34
343 0.35
344 0.36
345 0.37
346 0.35
347 0.3
348 0.23
349 0.21
350 0.2
351 0.21
352 0.21
353 0.23
354 0.22
355 0.23
356 0.29
357 0.28
358 0.27
359 0.29
360 0.33
361 0.33
362 0.38
363 0.36
364 0.29
365 0.29
366 0.3
367 0.26
368 0.21
369 0.2
370 0.15
371 0.2
372 0.2
373 0.23
374 0.22
375 0.21
376 0.23
377 0.29
378 0.3
379 0.3
380 0.37
381 0.42
382 0.53
383 0.62
384 0.69
385 0.73
386 0.81
387 0.86
388 0.89