Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AKD7

Protein Details
Accession A0A139AKD7    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-33VPKTRNTYCKGKACRKHTAHKVSQYKKGKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRNTYCKGKACRKHTAHKVSQYKKGKDSLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECNSCKYKHQLAIKRCKHFELGGEKKTKGAALSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.76
4 0.82
5 0.79
6 0.8
7 0.81
8 0.81
9 0.79
10 0.8
11 0.83
12 0.78
13 0.81
14 0.81
15 0.75
16 0.7
17 0.68
18 0.59
19 0.53
20 0.51
21 0.51
22 0.51
23 0.5
24 0.53
25 0.52
26 0.56
27 0.58
28 0.6
29 0.55
30 0.56
31 0.61
32 0.59
33 0.61
34 0.59
35 0.58
36 0.57
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.68
57 0.64
58 0.61
59 0.63
60 0.6
61 0.55
62 0.51
63 0.46
64 0.43
65 0.43
66 0.45
67 0.43
68 0.49
69 0.54
70 0.6
71 0.7
72 0.74
73 0.77
74 0.72
75 0.68
76 0.61
77 0.54
78 0.52
79 0.51
80 0.52
81 0.51
82 0.54
83 0.51
84 0.49
85 0.48
86 0.42