Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AC51

Protein Details
Accession A0A139AC51    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
119-175RSRLRSTKIKRARRSESRPSRKQSARSGSRRYPRRRRRRKRRRGRRGGRGGNKWEVGBasic
NLS Segment(s)
PositionSequence
119-171RSRLRSTKIKRARRSESRPSRKQSARSGSRRYPRRRRRRKRRRGRRGGRGGNK
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MQSFIPRTLNEVRHVEQDAEKVVRGEGGDLIYSKIARVRHELGPQGPTAVVVAAGEKQDVHPSGEDVRPAAEANGKASRSRVGKGDREDEESDASKSGSESDSESRSGLGEDGEDGAPRSRLRSTKIKRARRSESRPSRKQSARSGSRRYPRRRRRRKRRRGRRGGRGGNKWEVGRGVCHVGRASWLGGMDFVDESER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.41
3 0.35
4 0.34
5 0.32
6 0.28
7 0.26
8 0.22
9 0.2
10 0.19
11 0.17
12 0.15
13 0.12
14 0.11
15 0.11
16 0.11
17 0.12
18 0.12
19 0.11
20 0.11
21 0.13
22 0.14
23 0.16
24 0.22
25 0.25
26 0.3
27 0.34
28 0.38
29 0.37
30 0.38
31 0.35
32 0.3
33 0.25
34 0.19
35 0.15
36 0.1
37 0.08
38 0.05
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.1
46 0.11
47 0.12
48 0.11
49 0.12
50 0.16
51 0.17
52 0.17
53 0.14
54 0.13
55 0.12
56 0.12
57 0.11
58 0.11
59 0.1
60 0.13
61 0.17
62 0.17
63 0.17
64 0.18
65 0.22
66 0.2
67 0.21
68 0.24
69 0.25
70 0.3
71 0.34
72 0.39
73 0.35
74 0.39
75 0.38
76 0.33
77 0.3
78 0.25
79 0.22
80 0.16
81 0.15
82 0.09
83 0.08
84 0.09
85 0.07
86 0.06
87 0.08
88 0.1
89 0.11
90 0.12
91 0.12
92 0.11
93 0.11
94 0.1
95 0.08
96 0.06
97 0.05
98 0.04
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.08
105 0.08
106 0.1
107 0.12
108 0.14
109 0.19
110 0.3
111 0.35
112 0.45
113 0.55
114 0.63
115 0.69
116 0.75
117 0.8
118 0.8
119 0.82
120 0.83
121 0.84
122 0.85
123 0.84
124 0.82
125 0.82
126 0.78
127 0.77
128 0.75
129 0.74
130 0.74
131 0.74
132 0.75
133 0.74
134 0.78
135 0.81
136 0.82
137 0.82
138 0.83
139 0.86
140 0.89
141 0.92
142 0.94
143 0.96
144 0.97
145 0.97
146 0.97
147 0.98
148 0.98
149 0.97
150 0.97
151 0.96
152 0.96
153 0.94
154 0.92
155 0.87
156 0.82
157 0.75
158 0.64
159 0.55
160 0.47
161 0.38
162 0.31
163 0.28
164 0.27
165 0.24
166 0.26
167 0.24
168 0.21
169 0.23
170 0.23
171 0.21
172 0.15
173 0.15
174 0.13
175 0.13
176 0.13
177 0.12
178 0.1