Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AH34

Protein Details
Accession A0A139AH34   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
37-63TKPSCPFKITLRFRRPRERARRHTTTPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, cyto_nucl 11.5, mito 5, nucl 3
Family & Domain DBs
Amino Acid Sequences MDDTSRLLGKGGAKVDAPPVGLEGRIVVHTGLPSTVTKPSCPFKITLRFRRPRERARRHTTTPTTTAATTDTAATADPTITPRGVPGGAGSTPPPSSSSPSPLELAPPKPPLPPPMPVPLACPYTCSLTDVVRRWGVAELVASPRDELV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.22
4 0.2
5 0.15
6 0.15
7 0.14
8 0.13
9 0.12
10 0.1
11 0.09
12 0.09
13 0.09
14 0.08
15 0.08
16 0.08
17 0.09
18 0.08
19 0.09
20 0.09
21 0.11
22 0.16
23 0.16
24 0.18
25 0.22
26 0.26
27 0.28
28 0.29
29 0.29
30 0.31
31 0.41
32 0.49
33 0.55
34 0.61
35 0.67
36 0.72
37 0.81
38 0.81
39 0.81
40 0.83
41 0.83
42 0.83
43 0.83
44 0.84
45 0.78
46 0.8
47 0.75
48 0.68
49 0.6
50 0.52
51 0.44
52 0.37
53 0.32
54 0.23
55 0.18
56 0.14
57 0.11
58 0.08
59 0.07
60 0.06
61 0.06
62 0.05
63 0.04
64 0.04
65 0.06
66 0.07
67 0.06
68 0.06
69 0.06
70 0.07
71 0.07
72 0.07
73 0.06
74 0.07
75 0.08
76 0.08
77 0.09
78 0.09
79 0.1
80 0.1
81 0.12
82 0.11
83 0.15
84 0.16
85 0.21
86 0.22
87 0.24
88 0.24
89 0.22
90 0.26
91 0.26
92 0.27
93 0.26
94 0.28
95 0.27
96 0.28
97 0.31
98 0.32
99 0.31
100 0.32
101 0.32
102 0.35
103 0.37
104 0.35
105 0.37
106 0.35
107 0.36
108 0.32
109 0.3
110 0.24
111 0.26
112 0.26
113 0.23
114 0.2
115 0.21
116 0.28
117 0.3
118 0.34
119 0.31
120 0.3
121 0.3
122 0.3
123 0.26
124 0.2
125 0.17
126 0.15
127 0.17
128 0.18
129 0.18