Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AMU7

Protein Details
Accession A0A139AMU7    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
27-61SKIFRFCRSKCHKNFKMKRNPRKVRWTKAFRKAAGHydrophilic
NLS Segment(s)
PositionSequence
41-60FKMKRNPRKVRWTKAFRKAA
100-112IRKKRERAFTLKR
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MVRIDKCYFCSSTIYPGHGINFVRNDSKIFRFCRSKCHKNFKMKRNPRKVRWTKAFRKAAGKEMVIDSTFEFEKRRNVPVRYDRETMATTIKAMKRVLEIRKKRERAFTLKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.3
4 0.3
5 0.28
6 0.28
7 0.24
8 0.24
9 0.23
10 0.24
11 0.23
12 0.24
13 0.25
14 0.29
15 0.32
16 0.32
17 0.37
18 0.43
19 0.44
20 0.52
21 0.58
22 0.63
23 0.66
24 0.74
25 0.75
26 0.77
27 0.87
28 0.86
29 0.88
30 0.88
31 0.89
32 0.9
33 0.91
34 0.88
35 0.89
36 0.88
37 0.86
38 0.86
39 0.85
40 0.83
41 0.83
42 0.82
43 0.73
44 0.72
45 0.64
46 0.6
47 0.54
48 0.45
49 0.36
50 0.3
51 0.28
52 0.2
53 0.19
54 0.12
55 0.1
56 0.1
57 0.1
58 0.1
59 0.1
60 0.17
61 0.19
62 0.27
63 0.31
64 0.34
65 0.43
66 0.51
67 0.58
68 0.57
69 0.57
70 0.5
71 0.47
72 0.46
73 0.38
74 0.32
75 0.24
76 0.19
77 0.24
78 0.25
79 0.26
80 0.25
81 0.25
82 0.28
83 0.35
84 0.44
85 0.48
86 0.55
87 0.61
88 0.71
89 0.78
90 0.77
91 0.8
92 0.78