Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AWG0

Protein Details
Accession A0A139AWG0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-42KAPRLFHDSKERRIKRIRKLFDRLDTDKBasic
NLS Segment(s)
PositionSequence
24-32KERRIKRIR
Subcellular Location(s) plas 12, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR018247  EF_Hand_1_Ca_BS  
IPR002048  EF_hand_dom  
IPR002067  Mit_carrier  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005509  F:calcium ion binding  
GO:0055085  P:transmembrane transport  
Pfam View protein in Pfam  
PF13499  EF-hand_7  
PF00153  Mito_carr  
PROSITE View protein in PROSITE  
PS00018  EF_HAND_1  
PS50222  EF_HAND_2  
PS50920  SOLCAR  
Amino Acid Sequences MGANLDAASSQGHPKAPRLFHDSKERRIKRIRKLFDRLDTDKSGYVEFKELEYNILGLRGNAASEDTSRRLSRDFMSHADRDDDRRLSFEEFYEFVEGKEKELWKLFREMDQDSDGFVKRVDLMRAFSDAGVCIDEKGLDAFIGRADKDGNGLLDFPELRDFLIPLWKTSLPDIVQYYRDVYDPSLVIEFNPVVQPDPNKRLKSFLAGAVSGAVSRTSAAPLERIRVLMNTLTTKNQTFWRDFVNSAKAIYHADGVLGFWRGNLINVIRIAPSSAITFGVFEESKKTLARLEGVSGRDLSPLGRFLAGGSAGMVAMTTTYPFEVVQVRMMATVHVPSGTAADGRSPLLLRIVNGMYRDGGLRVFYNGLLPSMIGIVPYAGFNFMTYESLKQSYFRHLKRHAPPHTQVEPQSIVLLAFGIIATSSAATATYPLATVRTRLQAQGTPAHPFRYDGMVDVFRRTWQLEGWWGFYRGLPASLTKAVPSASLSYVVYEWAKTTLGIASKND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.38
3 0.41
4 0.45
5 0.5
6 0.52
7 0.54
8 0.64
9 0.64
10 0.66
11 0.73
12 0.72
13 0.72
14 0.78
15 0.81
16 0.81
17 0.84
18 0.84
19 0.83
20 0.88
21 0.87
22 0.86
23 0.85
24 0.79
25 0.75
26 0.68
27 0.61
28 0.55
29 0.47
30 0.4
31 0.32
32 0.3
33 0.27
34 0.24
35 0.22
36 0.23
37 0.21
38 0.21
39 0.2
40 0.19
41 0.14
42 0.15
43 0.14
44 0.1
45 0.12
46 0.1
47 0.1
48 0.09
49 0.1
50 0.09
51 0.12
52 0.17
53 0.17
54 0.22
55 0.23
56 0.24
57 0.25
58 0.27
59 0.28
60 0.31
61 0.32
62 0.33
63 0.38
64 0.38
65 0.39
66 0.4
67 0.38
68 0.36
69 0.38
70 0.36
71 0.3
72 0.31
73 0.32
74 0.31
75 0.3
76 0.27
77 0.24
78 0.21
79 0.22
80 0.23
81 0.2
82 0.17
83 0.23
84 0.22
85 0.2
86 0.26
87 0.25
88 0.25
89 0.32
90 0.34
91 0.29
92 0.36
93 0.35
94 0.34
95 0.37
96 0.36
97 0.32
98 0.33
99 0.3
100 0.25
101 0.26
102 0.22
103 0.18
104 0.16
105 0.14
106 0.13
107 0.17
108 0.18
109 0.17
110 0.19
111 0.2
112 0.22
113 0.22
114 0.19
115 0.17
116 0.14
117 0.13
118 0.11
119 0.1
120 0.08
121 0.07
122 0.07
123 0.07
124 0.07
125 0.06
126 0.05
127 0.05
128 0.05
129 0.07
130 0.09
131 0.08
132 0.09
133 0.09
134 0.09
135 0.11
136 0.12
137 0.1
138 0.09
139 0.09
140 0.09
141 0.1
142 0.1
143 0.09
144 0.1
145 0.09
146 0.09
147 0.09
148 0.09
149 0.08
150 0.16
151 0.15
152 0.14
153 0.18
154 0.19
155 0.19
156 0.2
157 0.24
158 0.17
159 0.19
160 0.22
161 0.2
162 0.2
163 0.2
164 0.21
165 0.17
166 0.17
167 0.15
168 0.13
169 0.13
170 0.11
171 0.11
172 0.1
173 0.1
174 0.09
175 0.1
176 0.09
177 0.08
178 0.09
179 0.08
180 0.08
181 0.09
182 0.13
183 0.18
184 0.26
185 0.32
186 0.34
187 0.34
188 0.37
189 0.37
190 0.38
191 0.34
192 0.3
193 0.25
194 0.22
195 0.22
196 0.18
197 0.17
198 0.12
199 0.1
200 0.06
201 0.04
202 0.04
203 0.05
204 0.05
205 0.06
206 0.06
207 0.09
208 0.1
209 0.13
210 0.13
211 0.13
212 0.13
213 0.12
214 0.13
215 0.11
216 0.12
217 0.12
218 0.13
219 0.14
220 0.15
221 0.15
222 0.16
223 0.2
224 0.22
225 0.21
226 0.21
227 0.24
228 0.24
229 0.24
230 0.25
231 0.24
232 0.21
233 0.2
234 0.19
235 0.15
236 0.14
237 0.13
238 0.11
239 0.07
240 0.07
241 0.06
242 0.06
243 0.06
244 0.06
245 0.05
246 0.05
247 0.06
248 0.06
249 0.06
250 0.07
251 0.07
252 0.08
253 0.08
254 0.09
255 0.08
256 0.08
257 0.08
258 0.07
259 0.08
260 0.06
261 0.06
262 0.06
263 0.06
264 0.06
265 0.06
266 0.08
267 0.08
268 0.08
269 0.1
270 0.1
271 0.12
272 0.12
273 0.12
274 0.11
275 0.12
276 0.15
277 0.12
278 0.14
279 0.17
280 0.18
281 0.18
282 0.18
283 0.17
284 0.15
285 0.14
286 0.12
287 0.09
288 0.09
289 0.09
290 0.08
291 0.08
292 0.07
293 0.09
294 0.08
295 0.07
296 0.06
297 0.05
298 0.05
299 0.05
300 0.04
301 0.03
302 0.03
303 0.03
304 0.03
305 0.03
306 0.03
307 0.04
308 0.04
309 0.06
310 0.08
311 0.09
312 0.11
313 0.11
314 0.11
315 0.11
316 0.11
317 0.1
318 0.08
319 0.08
320 0.07
321 0.06
322 0.06
323 0.06
324 0.06
325 0.06
326 0.06
327 0.06
328 0.06
329 0.07
330 0.08
331 0.09
332 0.08
333 0.08
334 0.11
335 0.11
336 0.1
337 0.13
338 0.14
339 0.15
340 0.15
341 0.16
342 0.13
343 0.13
344 0.13
345 0.1
346 0.09
347 0.09
348 0.08
349 0.09
350 0.1
351 0.09
352 0.11
353 0.1
354 0.1
355 0.09
356 0.09
357 0.07
358 0.07
359 0.07
360 0.05
361 0.05
362 0.05
363 0.05
364 0.05
365 0.05
366 0.05
367 0.05
368 0.05
369 0.07
370 0.07
371 0.09
372 0.1
373 0.11
374 0.13
375 0.15
376 0.16
377 0.17
378 0.18
379 0.27
380 0.35
381 0.38
382 0.45
383 0.49
384 0.59
385 0.66
386 0.75
387 0.73
388 0.73
389 0.74
390 0.74
391 0.73
392 0.68
393 0.6
394 0.55
395 0.48
396 0.4
397 0.34
398 0.26
399 0.21
400 0.15
401 0.13
402 0.07
403 0.05
404 0.05
405 0.04
406 0.03
407 0.04
408 0.04
409 0.04
410 0.04
411 0.04
412 0.04
413 0.04
414 0.05
415 0.06
416 0.06
417 0.06
418 0.07
419 0.1
420 0.1
421 0.13
422 0.16
423 0.22
424 0.23
425 0.25
426 0.29
427 0.29
428 0.33
429 0.38
430 0.36
431 0.37
432 0.37
433 0.38
434 0.35
435 0.33
436 0.31
437 0.28
438 0.27
439 0.22
440 0.25
441 0.28
442 0.29
443 0.31
444 0.3
445 0.25
446 0.28
447 0.27
448 0.23
449 0.19
450 0.21
451 0.26
452 0.28
453 0.32
454 0.33
455 0.34
456 0.33
457 0.32
458 0.32
459 0.24
460 0.23
461 0.2
462 0.18
463 0.21
464 0.24
465 0.24
466 0.21
467 0.21
468 0.2
469 0.2
470 0.2
471 0.18
472 0.16
473 0.18
474 0.17
475 0.17
476 0.17
477 0.19
478 0.18
479 0.15
480 0.15
481 0.14
482 0.14
483 0.12
484 0.14
485 0.15
486 0.18