Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139A0X6

Protein Details
Accession A0A139A0X6    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
80-103DHRCCACSGQKERRRGHRQEDPRCBasic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 8, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR002672  Ribosomal_L28e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSADLVWLIIRKNNSFLVKRNGIVLSREPGNLTNTHSFSASGLANPKVLGLLAIPRPPSFLTSGFTHLHLTIGTSWDAADHRCCACSGQKERRRGHRQEDPRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.4
4 0.45
5 0.45
6 0.44
7 0.44
8 0.4
9 0.35
10 0.35
11 0.31
12 0.26
13 0.24
14 0.24
15 0.21
16 0.21
17 0.22
18 0.2
19 0.21
20 0.22
21 0.22
22 0.22
23 0.21
24 0.19
25 0.17
26 0.19
27 0.14
28 0.1
29 0.12
30 0.12
31 0.11
32 0.11
33 0.11
34 0.08
35 0.08
36 0.06
37 0.04
38 0.06
39 0.08
40 0.09
41 0.1
42 0.1
43 0.12
44 0.12
45 0.13
46 0.13
47 0.12
48 0.14
49 0.15
50 0.19
51 0.19
52 0.19
53 0.19
54 0.17
55 0.16
56 0.13
57 0.13
58 0.09
59 0.1
60 0.09
61 0.08
62 0.08
63 0.09
64 0.1
65 0.1
66 0.11
67 0.13
68 0.13
69 0.14
70 0.15
71 0.16
72 0.22
73 0.3
74 0.38
75 0.46
76 0.53
77 0.62
78 0.71
79 0.79
80 0.82
81 0.81
82 0.81
83 0.81