Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A138ZZZ9

Protein Details
Accession A0A138ZZZ9   
Localization Confidence High
Confidence Score 19.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-42KGADAARKKKGQPSRKGKKAWAKNIDITHydrophilic
295-324DGDADVKKKEPKRKTRQERNREARRKEIERBasic
NLS Segment(s)
PositionSequence
19-35AARKKKGQPSRKGKKAW
122-159RALAKKKREASKTWAELVERKRRKLENGKALVQRRPGK
245-249RKRRE
301-337KKKEPKRKTRQERNREARRKEIEREEAARKEAKKLEK
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0000027  P:ribosomal large subunit assembly  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MPDVSTAMTPSDGEKGADAARKKKGQPSRKGKKAWAKNIDITDVESALDDLRTDERVHGGRLSSLPDSALFSVDKSGDTATVVSLAKAKKRLRIDEILTPDSKIPGVSSRARARGELNSEQRALAKKKREASKTWAELVERKRRKLENGKALVQRRPGKGASVEPIWTVLDTVATAPTPEAASPPALEFIPPAVVPKRPSTLYIPPIQQVALSTLPHPGASYNPTFEDHQEALREAVTVEEEKARKRREAEERAGGPNRAGNVERRNAMPGEEEVDGSDEDEEEEEEKEGSEVDDGDADVKKKEPKRKTRQERNREARRKEIEREEAARKEAKKLEKQLKNLPNIVASLPRTGPTDPAQAPSKPSKPPRLGPHRAEPPVARVLLTEELPDALRKLQPEGNLLEDMATSMFAKGVMERRIYKQNGAGKFTGKGGKNTRKEFETHTYKRFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.2
4 0.25
5 0.29
6 0.32
7 0.4
8 0.46
9 0.5
10 0.58
11 0.64
12 0.68
13 0.74
14 0.79
15 0.81
16 0.84
17 0.87
18 0.87
19 0.88
20 0.88
21 0.88
22 0.86
23 0.82
24 0.8
25 0.75
26 0.69
27 0.59
28 0.5
29 0.41
30 0.31
31 0.24
32 0.17
33 0.14
34 0.11
35 0.1
36 0.08
37 0.08
38 0.09
39 0.11
40 0.12
41 0.13
42 0.18
43 0.2
44 0.22
45 0.22
46 0.21
47 0.23
48 0.23
49 0.26
50 0.21
51 0.2
52 0.18
53 0.17
54 0.19
55 0.16
56 0.16
57 0.12
58 0.12
59 0.14
60 0.14
61 0.13
62 0.11
63 0.12
64 0.1
65 0.11
66 0.1
67 0.08
68 0.11
69 0.11
70 0.11
71 0.15
72 0.17
73 0.21
74 0.3
75 0.33
76 0.37
77 0.44
78 0.5
79 0.52
80 0.58
81 0.58
82 0.57
83 0.6
84 0.57
85 0.5
86 0.45
87 0.38
88 0.31
89 0.27
90 0.19
91 0.13
92 0.13
93 0.18
94 0.22
95 0.29
96 0.34
97 0.4
98 0.41
99 0.41
100 0.39
101 0.4
102 0.42
103 0.43
104 0.43
105 0.4
106 0.4
107 0.39
108 0.39
109 0.4
110 0.39
111 0.38
112 0.41
113 0.43
114 0.51
115 0.59
116 0.62
117 0.6
118 0.62
119 0.65
120 0.61
121 0.59
122 0.53
123 0.46
124 0.47
125 0.5
126 0.53
127 0.49
128 0.48
129 0.51
130 0.52
131 0.6
132 0.64
133 0.65
134 0.65
135 0.65
136 0.69
137 0.7
138 0.71
139 0.66
140 0.63
141 0.6
142 0.51
143 0.49
144 0.42
145 0.38
146 0.36
147 0.34
148 0.3
149 0.24
150 0.23
151 0.19
152 0.19
153 0.17
154 0.14
155 0.11
156 0.07
157 0.06
158 0.05
159 0.05
160 0.05
161 0.05
162 0.05
163 0.04
164 0.05
165 0.05
166 0.05
167 0.06
168 0.06
169 0.07
170 0.07
171 0.07
172 0.08
173 0.07
174 0.07
175 0.07
176 0.06
177 0.07
178 0.07
179 0.08
180 0.09
181 0.11
182 0.13
183 0.16
184 0.18
185 0.17
186 0.2
187 0.23
188 0.28
189 0.3
190 0.32
191 0.31
192 0.29
193 0.29
194 0.26
195 0.21
196 0.15
197 0.14
198 0.11
199 0.1
200 0.1
201 0.11
202 0.11
203 0.11
204 0.1
205 0.08
206 0.08
207 0.1
208 0.11
209 0.1
210 0.11
211 0.13
212 0.13
213 0.14
214 0.17
215 0.14
216 0.15
217 0.14
218 0.14
219 0.12
220 0.12
221 0.11
222 0.07
223 0.06
224 0.06
225 0.06
226 0.06
227 0.1
228 0.11
229 0.15
230 0.21
231 0.24
232 0.26
233 0.29
234 0.36
235 0.42
236 0.5
237 0.52
238 0.53
239 0.54
240 0.56
241 0.55
242 0.47
243 0.37
244 0.3
245 0.25
246 0.19
247 0.16
248 0.16
249 0.19
250 0.22
251 0.23
252 0.22
253 0.24
254 0.22
255 0.22
256 0.19
257 0.14
258 0.14
259 0.13
260 0.12
261 0.1
262 0.11
263 0.1
264 0.09
265 0.08
266 0.05
267 0.05
268 0.05
269 0.05
270 0.05
271 0.06
272 0.06
273 0.06
274 0.06
275 0.06
276 0.06
277 0.05
278 0.05
279 0.05
280 0.05
281 0.05
282 0.05
283 0.07
284 0.08
285 0.09
286 0.09
287 0.12
288 0.19
289 0.25
290 0.35
291 0.44
292 0.54
293 0.64
294 0.75
295 0.84
296 0.88
297 0.93
298 0.94
299 0.95
300 0.95
301 0.95
302 0.93
303 0.87
304 0.85
305 0.83
306 0.78
307 0.74
308 0.71
309 0.67
310 0.63
311 0.64
312 0.6
313 0.54
314 0.51
315 0.49
316 0.42
317 0.41
318 0.43
319 0.45
320 0.47
321 0.54
322 0.61
323 0.63
324 0.68
325 0.72
326 0.73
327 0.71
328 0.66
329 0.57
330 0.48
331 0.43
332 0.37
333 0.32
334 0.25
335 0.23
336 0.2
337 0.2
338 0.21
339 0.2
340 0.22
341 0.2
342 0.27
343 0.24
344 0.29
345 0.31
346 0.3
347 0.35
348 0.39
349 0.41
350 0.42
351 0.5
352 0.55
353 0.58
354 0.65
355 0.71
356 0.74
357 0.78
358 0.76
359 0.78
360 0.77
361 0.73
362 0.69
363 0.59
364 0.54
365 0.5
366 0.44
367 0.34
368 0.25
369 0.26
370 0.24
371 0.23
372 0.18
373 0.13
374 0.14
375 0.14
376 0.15
377 0.12
378 0.12
379 0.14
380 0.15
381 0.19
382 0.21
383 0.23
384 0.27
385 0.28
386 0.28
387 0.27
388 0.26
389 0.22
390 0.18
391 0.16
392 0.12
393 0.1
394 0.07
395 0.07
396 0.07
397 0.07
398 0.07
399 0.1
400 0.17
401 0.21
402 0.26
403 0.3
404 0.35
405 0.45
406 0.48
407 0.48
408 0.49
409 0.52
410 0.53
411 0.55
412 0.52
413 0.45
414 0.44
415 0.45
416 0.46
417 0.41
418 0.43
419 0.48
420 0.56
421 0.62
422 0.68
423 0.68
424 0.63
425 0.64
426 0.63
427 0.63
428 0.63
429 0.62