FuNGI

A0A138ZXW5

Protein Details

Accession

A0A138ZXW5

Localization Confidence

Low

Confidence Score

9.4

NoLS Segment(s)

Position	Sequence	Protein Nature
55-82	QSPTCPTPKLKRRSTSPAQRDAKRRLSD	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 17, cyto_nucl 11.5, mito 6, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR010285 DNA_helicase_pif1-like IPR027417 P-loop_NTPase
Gene Ontology	GO:0005524 F:ATP binding GO:0016887 F:ATP hydrolysis activity GO:0003678 F:DNA helicase activity GO:0006310 P:DNA recombination GO:0006281 P:DNA repair GO:0000723 P:telomere maintenance
Pfam	View protein in Pfam PF05970 PIF1

Amino Acid Sequences

MNGQSQSFPLSRGTPTSPSTPPMHRTQSSSISSFSSRNPLSPRSPRSPSRSPAPQSPTCPTPKLKRRSTSPAQRDAKRRLSDKENPFHNSDGIRAQTPAPPPRPLSPPSPTPSPHPLSQNDHSNIGSTRRVAGPRPMPFSSPGAAQLPNHPSFRRRQPAPISVAGAEHLWDTEEDEAHGWMDVFAFPTQANIMNAPVGASSLTRIRGEPPPSNISSTSTTSRLPTHLGSPPHPTAADLDSEADESFTTALSSTSAGPIEPSPPGSFPPSPPNAAPVAPVLVLSSPLPPPFPPPLLDHELDFIPLLSQPPPPTYAEDQARIDRQKKEVMAQNGARWLRDMGIPTPSMRGLGTTLHPLPNATPASVPPELPPTTPKSGRTFTFRSPAPPSPMRLTTSNPAIPAVPAVPAVPAEPVELAEPAETVGPAGLVGPATPAPAASPPGLALTEPQLRAVRLAREGRNVFLTGGAGCGKSLVVRECVRELQAAGKKVVVTASTGIAATHVKGRTIHSFAGIGPGLLTKEVRASEKTAVLVFFFGGGGEAKDPLSVE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.3
2	0.33
3	0.37
4	0.36
5	0.38
6	0.42
7	0.43
8	0.44
9	0.47
10	0.52
11	0.49
12	0.52
13	0.54
14	0.57
15	0.55
16	0.52
17	0.45
18	0.41
19	0.41
20	0.37
21	0.33
22	0.34
23	0.3
24	0.34
25	0.37
26	0.4
27	0.46
28	0.54
29	0.6
30	0.59
31	0.66
32	0.69
33	0.72
34	0.74
35	0.71
36	0.7
37	0.72
38	0.69
39	0.71
40	0.71
41	0.69
42	0.66
43	0.66
44	0.63
45	0.59
46	0.59
47	0.57
48	0.59
49	0.63
50	0.67
51	0.71
52	0.72
53	0.75
54	0.79
55	0.83
56	0.83
57	0.82
58	0.83
59	0.82
60	0.82
61	0.82
62	0.82
63	0.81
64	0.77
65	0.73
66	0.69
67	0.7
68	0.72
69	0.73
70	0.72
71	0.7
72	0.67
73	0.65
74	0.6
75	0.54
76	0.45
77	0.37
78	0.33
79	0.29
80	0.25
81	0.24
82	0.23
83	0.25
84	0.31
85	0.37
86	0.36
87	0.38
88	0.4
89	0.44
90	0.48
91	0.46
92	0.46
93	0.43
94	0.46
95	0.47
96	0.5
97	0.46
98	0.47
99	0.52
100	0.5
101	0.49
102	0.47
103	0.47
104	0.49
105	0.53
106	0.56
107	0.5
108	0.48
109	0.43
110	0.4
111	0.36
112	0.32
113	0.29
114	0.2
115	0.21
116	0.23
117	0.25
118	0.25
119	0.32
120	0.36
121	0.4
122	0.45
123	0.43
124	0.41
125	0.41
126	0.42
127	0.34
128	0.27
129	0.24
130	0.2
131	0.21
132	0.19
133	0.23
134	0.27
135	0.29
136	0.31
137	0.3
138	0.3
139	0.36
140	0.46
141	0.48
142	0.45
143	0.5
144	0.55
145	0.61
146	0.63
147	0.59
148	0.51
149	0.42
150	0.4
151	0.32
152	0.24
153	0.16
154	0.11
155	0.08
156	0.06
157	0.05
158	0.06
159	0.07
160	0.07
161	0.07
162	0.07
163	0.08
164	0.07
165	0.07
166	0.06
167	0.05
168	0.06
169	0.05
170	0.07
171	0.06
172	0.07
173	0.07
174	0.07
175	0.08
176	0.09
177	0.1
178	0.08
179	0.09
180	0.08
181	0.08
182	0.08
183	0.07
184	0.05
185	0.05
186	0.04
187	0.05
188	0.07
189	0.09
190	0.1
191	0.1
192	0.13
193	0.19
194	0.25
195	0.27
196	0.3
197	0.33
198	0.34
199	0.35
200	0.33
201	0.3
202	0.28
203	0.27
204	0.25
205	0.21
206	0.21
207	0.21
208	0.22
209	0.19
210	0.18
211	0.16
212	0.18
213	0.21
214	0.23
215	0.23
216	0.28
217	0.28
218	0.26
219	0.25
220	0.22
221	0.19
222	0.17
223	0.16
224	0.1
225	0.1
226	0.09
227	0.1
228	0.09
229	0.07
230	0.06
231	0.05
232	0.05
233	0.04
234	0.04
235	0.04
236	0.04
237	0.04
238	0.05
239	0.05
240	0.06
241	0.06
242	0.06
243	0.06
244	0.07
245	0.08
246	0.07
247	0.09
248	0.08
249	0.09
250	0.1
251	0.14
252	0.14
253	0.15
254	0.21
255	0.22
256	0.23
257	0.22
258	0.23
259	0.21
260	0.2
261	0.18
262	0.12
263	0.11
264	0.09
265	0.09
266	0.07
267	0.05
268	0.06
269	0.06
270	0.07
271	0.07
272	0.07
273	0.08
274	0.08
275	0.11
276	0.13
277	0.14
278	0.15
279	0.16
280	0.22
281	0.25
282	0.26
283	0.22
284	0.21
285	0.2
286	0.18
287	0.16
288	0.1
289	0.06
290	0.06
291	0.07
292	0.06
293	0.08
294	0.09
295	0.1
296	0.12
297	0.13
298	0.16
299	0.18
300	0.23
301	0.24
302	0.26
303	0.27
304	0.28
305	0.32
306	0.32
307	0.34
308	0.31
309	0.31
310	0.32
311	0.32
312	0.34
313	0.36
314	0.36
315	0.38
316	0.37
317	0.36
318	0.38
319	0.37
320	0.32
321	0.26
322	0.22
323	0.17
324	0.16
325	0.17
326	0.12
327	0.14
328	0.15
329	0.14
330	0.15
331	0.14
332	0.13
333	0.11
334	0.1
335	0.08
336	0.1
337	0.1
338	0.13
339	0.15
340	0.15
341	0.16
342	0.15
343	0.15
344	0.19
345	0.18
346	0.14
347	0.13
348	0.13
349	0.19
350	0.19
351	0.19
352	0.14
353	0.19
354	0.19
355	0.2
356	0.22
357	0.22
358	0.28
359	0.3
360	0.33
361	0.34
362	0.37
363	0.38
364	0.42
365	0.41
366	0.39
367	0.43
368	0.4
369	0.39
370	0.42
371	0.44
372	0.44
373	0.43
374	0.43
375	0.42
376	0.44
377	0.42
378	0.37
379	0.37
380	0.34
381	0.37
382	0.34
383	0.29
384	0.27
385	0.24
386	0.22
387	0.19
388	0.15
389	0.09
390	0.08
391	0.08
392	0.07
393	0.07
394	0.07
395	0.07
396	0.07
397	0.07
398	0.07
399	0.07
400	0.07
401	0.07
402	0.07
403	0.07
404	0.06
405	0.06
406	0.06
407	0.06
408	0.05
409	0.04
410	0.04
411	0.04
412	0.04
413	0.04
414	0.04
415	0.04
416	0.05
417	0.05
418	0.06
419	0.06
420	0.06
421	0.06
422	0.08
423	0.1
424	0.1
425	0.1
426	0.1
427	0.11
428	0.12
429	0.11
430	0.1
431	0.13
432	0.19
433	0.18
434	0.21
435	0.22
436	0.22
437	0.25
438	0.28
439	0.26
440	0.28
441	0.35
442	0.35
443	0.42
444	0.43
445	0.43
446	0.42
447	0.39
448	0.32
449	0.25
450	0.23
451	0.14
452	0.14
453	0.13
454	0.1
455	0.09
456	0.09
457	0.08
458	0.09
459	0.12
460	0.13
461	0.18
462	0.2
463	0.23
464	0.27
465	0.29
466	0.29
467	0.27
468	0.26
469	0.29
470	0.32
471	0.32
472	0.3
473	0.29
474	0.28
475	0.27
476	0.28
477	0.19
478	0.15
479	0.14
480	0.14
481	0.13
482	0.13
483	0.12
484	0.12
485	0.12
486	0.11
487	0.16
488	0.16
489	0.17
490	0.19
491	0.23
492	0.29
493	0.32
494	0.32
495	0.28
496	0.28
497	0.26
498	0.31
499	0.27
500	0.2
501	0.16
502	0.16
503	0.14
504	0.15
505	0.15
506	0.09
507	0.13
508	0.16
509	0.19
510	0.21
511	0.24
512	0.28
513	0.3
514	0.31
515	0.29
516	0.27
517	0.24
518	0.22
519	0.18
520	0.14
521	0.11
522	0.09
523	0.08
524	0.08
525	0.08
526	0.09
527	0.09
528	0.09

A0A138ZXW5

3D AlphaFold-predicted Structure Viewer