Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139API0

Protein Details
Accession A0A139API0    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-36GKTRLSRWYKHLPPKDKARYHREVBasic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044733  AP1_sigma  
IPR016635  AP_complex_ssu  
IPR022775  AP_mu_sigma_su  
IPR000804  Clathrin_sm-chain_CS  
IPR011012  Longin-like_dom_sf  
Gene Ontology GO:0030121  C:AP-1 adaptor complex  
GO:0035615  F:clathrin adaptor activity  
GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF01217  Clat_adaptor_s  
PROSITE View protein in PROSITE  
PS00989  CLAT_ADAPTOR_S  
CDD cd14831  AP1_sigma  
Amino Acid Sequences MTIHFMLLVNRQGKTRLSRWYKHLPPKDKARYHREVGQLVTSRTPKMTNVVDHKDFKLVYRRYASLYFIVGVDADENELIMLEVIHRYVELLDRYFGNVCELDLIYNFHKAYYVLDELVMAGEMIETSKKTALRAVTQQDSLAEQQEDGEFEGRRNAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.4
4 0.46
5 0.51
6 0.57
7 0.65
8 0.7
9 0.74
10 0.79
11 0.77
12 0.76
13 0.81
14 0.85
15 0.83
16 0.82
17 0.8
18 0.77
19 0.73
20 0.72
21 0.67
22 0.6
23 0.53
24 0.51
25 0.45
26 0.39
27 0.39
28 0.34
29 0.29
30 0.27
31 0.26
32 0.2
33 0.22
34 0.24
35 0.25
36 0.3
37 0.36
38 0.4
39 0.41
40 0.41
41 0.39
42 0.36
43 0.32
44 0.34
45 0.29
46 0.3
47 0.31
48 0.31
49 0.31
50 0.33
51 0.32
52 0.23
53 0.22
54 0.17
55 0.13
56 0.12
57 0.09
58 0.08
59 0.06
60 0.05
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.02
68 0.02
69 0.02
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.06
77 0.07
78 0.08
79 0.09
80 0.09
81 0.1
82 0.11
83 0.11
84 0.1
85 0.09
86 0.08
87 0.09
88 0.09
89 0.08
90 0.08
91 0.1
92 0.09
93 0.12
94 0.12
95 0.11
96 0.11
97 0.11
98 0.12
99 0.14
100 0.15
101 0.12
102 0.12
103 0.12
104 0.11
105 0.11
106 0.09
107 0.05
108 0.03
109 0.03
110 0.03
111 0.04
112 0.05
113 0.05
114 0.06
115 0.1
116 0.11
117 0.12
118 0.16
119 0.19
120 0.24
121 0.31
122 0.37
123 0.38
124 0.38
125 0.38
126 0.34
127 0.34
128 0.29
129 0.26
130 0.19
131 0.15
132 0.15
133 0.15
134 0.15
135 0.14
136 0.16
137 0.13
138 0.14