Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AFL3

Protein Details
Accession A0A139AFL3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-44SKSEASKNGGRKTRRRQDEGEQQRATHydrophilic
NLS Segment(s)
PositionSequence
28-32GRKTR
Subcellular Location(s) nucl 11.5, cyto_nucl 10, cyto 5.5, mito 5, pero 4
Family & Domain DBs
Amino Acid Sequences MKRKNREPESVESRGSGDSKSEASKNGGRKTRRRQDEGEQQRATQGRYDHDPSCSDTKCELCGDGELEISVVVRRDASGGSANGGADDGDESPSATDLLKLALSEKSVYERARDADYPLQRPESGDGDGGTLDPALADRESHQALRLQWASARRQPTDLDMLRLRATCVRELGGFVKSGDILDDAEKAYEDILEVGMPEGLSSEDVARWVSRRAATWGGLWRTMMEKHEPDSDSEDEAAPSQQNASAAAAVWMDSDEQKLVEKAVASLDKASLLTTIAIITN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.37
3 0.28
4 0.21
5 0.18
6 0.19
7 0.23
8 0.23
9 0.23
10 0.27
11 0.33
12 0.39
13 0.46
14 0.51
15 0.56
16 0.64
17 0.73
18 0.77
19 0.81
20 0.8
21 0.77
22 0.79
23 0.81
24 0.81
25 0.8
26 0.71
27 0.62
28 0.6
29 0.57
30 0.48
31 0.41
32 0.33
33 0.27
34 0.32
35 0.37
36 0.33
37 0.33
38 0.34
39 0.34
40 0.38
41 0.35
42 0.31
43 0.3
44 0.29
45 0.29
46 0.28
47 0.24
48 0.18
49 0.19
50 0.17
51 0.14
52 0.13
53 0.1
54 0.09
55 0.08
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.06
62 0.06
63 0.07
64 0.08
65 0.11
66 0.1
67 0.12
68 0.12
69 0.12
70 0.11
71 0.11
72 0.09
73 0.06
74 0.06
75 0.05
76 0.05
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.08
91 0.08
92 0.08
93 0.11
94 0.15
95 0.15
96 0.15
97 0.17
98 0.18
99 0.2
100 0.2
101 0.2
102 0.24
103 0.27
104 0.29
105 0.28
106 0.28
107 0.25
108 0.25
109 0.24
110 0.19
111 0.16
112 0.13
113 0.12
114 0.11
115 0.1
116 0.1
117 0.07
118 0.05
119 0.04
120 0.03
121 0.03
122 0.04
123 0.04
124 0.04
125 0.05
126 0.08
127 0.09
128 0.09
129 0.1
130 0.12
131 0.13
132 0.17
133 0.17
134 0.14
135 0.16
136 0.19
137 0.23
138 0.24
139 0.28
140 0.24
141 0.25
142 0.25
143 0.25
144 0.3
145 0.26
146 0.26
147 0.23
148 0.24
149 0.24
150 0.23
151 0.22
152 0.17
153 0.18
154 0.15
155 0.15
156 0.14
157 0.13
158 0.15
159 0.16
160 0.13
161 0.12
162 0.11
163 0.1
164 0.09
165 0.09
166 0.08
167 0.06
168 0.06
169 0.06
170 0.07
171 0.07
172 0.07
173 0.07
174 0.06
175 0.06
176 0.05
177 0.05
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.05
190 0.05
191 0.05
192 0.06
193 0.07
194 0.08
195 0.09
196 0.11
197 0.14
198 0.15
199 0.17
200 0.21
201 0.23
202 0.24
203 0.27
204 0.32
205 0.31
206 0.3
207 0.28
208 0.25
209 0.24
210 0.25
211 0.24
212 0.22
213 0.22
214 0.24
215 0.3
216 0.3
217 0.29
218 0.32
219 0.31
220 0.28
221 0.27
222 0.24
223 0.19
224 0.19
225 0.18
226 0.13
227 0.12
228 0.1
229 0.11
230 0.11
231 0.11
232 0.12
233 0.1
234 0.1
235 0.1
236 0.1
237 0.08
238 0.08
239 0.07
240 0.07
241 0.08
242 0.09
243 0.09
244 0.09
245 0.11
246 0.11
247 0.12
248 0.13
249 0.13
250 0.12
251 0.18
252 0.19
253 0.18
254 0.19
255 0.19
256 0.18
257 0.18
258 0.17
259 0.12
260 0.11
261 0.1
262 0.09