FuNGI

A0A139ALU4

Protein Details

Accession

A0A139ALU4

Localization Confidence

Medium

Confidence Score

13.1

NoLS Segment(s)

Position	Sequence	Protein Nature
182-206	EEEAERKRKKREREEQERKRREKEA	Basic

NLS Segment(s)

Position	Sequence
175-204	RRRRVAEEEEAERKRKKREREEQERKRREK

Subcellular Location(s)

nucl 18.5, cyto_nucl 12.5, cyto 5.5

Family & Domain DBs

InterPro	View protein in InterPro IPR038765 Papain-like_cys_pep_sf
CDD	cd22758 OTU_232R-like

Amino Acid Sequences

MYSGSSSLHTRKSIQEVPPPRPSHSARVIPISSSTDSNTSTTYTSSYQHPPPSAYPTSPTRVPASRTEKRRTRPAGISLRYYDDPDALGSLFGSFPGYGADYEPQYGDRRTLWSNLSDPSRYPFAGLFQSLPPSPYHSYLEPTYIDPSELAAAEHRYRSDFRAAVEESVVSEAARRRRVAEEEEAERKRKKREREEQERKRREKEAMERTDELIAAQLQEDESALFASRTSYSYLSPDDTVSYPSTLSLSLAPPSSLSASSTTTPRANLFSALRTANYTPYDVGAGGDCLFLSLAQTHLGTPTHHSSVRRRIVSEIRAHRDLYEPDVLAMVGREDDAAFEEYCARMERQGECGDAVCVAAFARSEGVDVVVWFWDEKTGKLGRVLFEHSPNSVTDSDSDSGASAHKVARARPVRNLGWYRSISGDETMNHYVAVYPPGEAPGRG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.5
2	0.55
3	0.58
4	0.63
5	0.69
6	0.67
7	0.63
8	0.63
9	0.61
10	0.6
11	0.6
12	0.61
13	0.54
14	0.59
15	0.56
16	0.49
17	0.47
18	0.43
19	0.36
20	0.3
21	0.28
22	0.23
23	0.24
24	0.24
25	0.22
26	0.19
27	0.18
28	0.17
29	0.18
30	0.17
31	0.18
32	0.22
33	0.28
34	0.32
35	0.37
36	0.39
37	0.4
38	0.41
39	0.46
40	0.45
41	0.4
42	0.39
43	0.39
44	0.42
45	0.4
46	0.4
47	0.38
48	0.38
49	0.4
50	0.45
51	0.49
52	0.53
53	0.59
54	0.66
55	0.69
56	0.72
57	0.79
58	0.76
59	0.74
60	0.73
61	0.74
62	0.75
63	0.7
64	0.68
65	0.6
66	0.58
67	0.51
68	0.46
69	0.37
70	0.27
71	0.24
72	0.18
73	0.17
74	0.11
75	0.1
76	0.08
77	0.08
78	0.07
79	0.06
80	0.07
81	0.06
82	0.06
83	0.07
84	0.08
85	0.07
86	0.09
87	0.11
88	0.1
89	0.11
90	0.12
91	0.13
92	0.15
93	0.15
94	0.16
95	0.15
96	0.19
97	0.2
98	0.23
99	0.23
100	0.23
101	0.25
102	0.27
103	0.3
104	0.27
105	0.26
106	0.26
107	0.27
108	0.24
109	0.23
110	0.19
111	0.18
112	0.19
113	0.2
114	0.18
115	0.15
116	0.19
117	0.17
118	0.18
119	0.16
120	0.18
121	0.2
122	0.21
123	0.23
124	0.21
125	0.24
126	0.24
127	0.26
128	0.22
129	0.21
130	0.21
131	0.18
132	0.17
133	0.13
134	0.13
135	0.11
136	0.1
137	0.09
138	0.08
139	0.1
140	0.12
141	0.13
142	0.13
143	0.14
144	0.16
145	0.18
146	0.22
147	0.2
148	0.19
149	0.24
150	0.25
151	0.23
152	0.22
153	0.19
154	0.14
155	0.13
156	0.13
157	0.06
158	0.08
159	0.11
160	0.17
161	0.2
162	0.2
163	0.22
164	0.25
165	0.29
166	0.31
167	0.33
168	0.32
169	0.33
170	0.41
171	0.41
172	0.42
173	0.44
174	0.43
175	0.47
176	0.49
177	0.54
178	0.57
179	0.66
180	0.72
181	0.79
182	0.87
183	0.88
184	0.93
185	0.93
186	0.87
187	0.81
188	0.74
189	0.68
190	0.65
191	0.64
192	0.63
193	0.58
194	0.58
195	0.54
196	0.51
197	0.47
198	0.38
199	0.28
200	0.18
201	0.12
202	0.07
203	0.06
204	0.05
205	0.04
206	0.04
207	0.04
208	0.03
209	0.03
210	0.03
211	0.03
212	0.03
213	0.03
214	0.05
215	0.05
216	0.06
217	0.08
218	0.09
219	0.09
220	0.11
221	0.12
222	0.13
223	0.13
224	0.12
225	0.12
226	0.11
227	0.13
228	0.12
229	0.11
230	0.1
231	0.09
232	0.09
233	0.08
234	0.08
235	0.07
236	0.07
237	0.08
238	0.09
239	0.08
240	0.08
241	0.09
242	0.09
243	0.08
244	0.08
245	0.08
246	0.1
247	0.11
248	0.12
249	0.14
250	0.14
251	0.15
252	0.15
253	0.16
254	0.15
255	0.16
256	0.16
257	0.15
258	0.17
259	0.17
260	0.16
261	0.16
262	0.16
263	0.17
264	0.17
265	0.16
266	0.14
267	0.13
268	0.14
269	0.11
270	0.11
271	0.08
272	0.07
273	0.07
274	0.06
275	0.06
276	0.05
277	0.05
278	0.04
279	0.05
280	0.04
281	0.05
282	0.06
283	0.06
284	0.06
285	0.08
286	0.09
287	0.09
288	0.13
289	0.16
290	0.19
291	0.21
292	0.25
293	0.3
294	0.4
295	0.47
296	0.45
297	0.43
298	0.45
299	0.49
300	0.53
301	0.55
302	0.54
303	0.52
304	0.52
305	0.51
306	0.47
307	0.44
308	0.38
309	0.34
310	0.28
311	0.22
312	0.2
313	0.19
314	0.18
315	0.14
316	0.12
317	0.08
318	0.05
319	0.05
320	0.05
321	0.04
322	0.05
323	0.07
324	0.09
325	0.09
326	0.09
327	0.1
328	0.1
329	0.12
330	0.14
331	0.12
332	0.13
333	0.16
334	0.17
335	0.21
336	0.23
337	0.23
338	0.21
339	0.21
340	0.19
341	0.16
342	0.14
343	0.09
344	0.07
345	0.06
346	0.06
347	0.05
348	0.05
349	0.06
350	0.06
351	0.07
352	0.07
353	0.08
354	0.07
355	0.08
356	0.08
357	0.07
358	0.08
359	0.07
360	0.07
361	0.12
362	0.12
363	0.13
364	0.18
365	0.2
366	0.22
367	0.27
368	0.3
369	0.26
370	0.29
371	0.34
372	0.32
373	0.35
374	0.35
375	0.31
376	0.3
377	0.28
378	0.28
379	0.24
380	0.21
381	0.17
382	0.2
383	0.2
384	0.19
385	0.18
386	0.15
387	0.15
388	0.15
389	0.14
390	0.11
391	0.12
392	0.16
393	0.18
394	0.2
395	0.3
396	0.38
397	0.41
398	0.48
399	0.55
400	0.54
401	0.6
402	0.65
403	0.59
404	0.59
405	0.57
406	0.51
407	0.45
408	0.44
409	0.36
410	0.31
411	0.3
412	0.23
413	0.28
414	0.28
415	0.25
416	0.23
417	0.21
418	0.2
419	0.19
420	0.21
421	0.15
422	0.13
423	0.13
424	0.17

A0A139ALU4

3D AlphaFold-predicted Structure Viewer