Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AE02

Protein Details
Accession A0A139AE02    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
19-45EAADAKPKKAVKKSKKKPQDGKTENEVHydrophilic
NLS Segment(s)
PositionSequence
24-36KPKKAVKKSKKKP
Subcellular Location(s) nucl 18, cyto 6, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MKRSADDLDDDTFVDGDAEAADAKPKKAVKKSKKKPQDGKTENEVQIPSELTVPKSYDGPRDSSDVIHFLGQCVPDLNLKSKRKGTDPIWIVAVMSAERLTKKIVSSDIGCAAKLFGRHMKMPEQVEFLAGRKVSVAVGTPNRLVKLMEISTLRKAQVLVLDGTYHDKKQRTISTLNETKDDIRSLTSLAVSLGMKIAIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.06
4 0.05
5 0.06
6 0.05
7 0.05
8 0.11
9 0.13
10 0.13
11 0.19
12 0.23
13 0.31
14 0.4
15 0.51
16 0.57
17 0.67
18 0.77
19 0.83
20 0.9
21 0.93
22 0.93
23 0.92
24 0.92
25 0.86
26 0.82
27 0.79
28 0.77
29 0.67
30 0.6
31 0.51
32 0.4
33 0.35
34 0.29
35 0.22
36 0.16
37 0.16
38 0.14
39 0.16
40 0.16
41 0.15
42 0.18
43 0.19
44 0.22
45 0.23
46 0.26
47 0.25
48 0.28
49 0.28
50 0.25
51 0.25
52 0.2
53 0.19
54 0.17
55 0.15
56 0.12
57 0.13
58 0.12
59 0.11
60 0.1
61 0.1
62 0.11
63 0.12
64 0.18
65 0.25
66 0.28
67 0.32
68 0.36
69 0.38
70 0.39
71 0.44
72 0.41
73 0.41
74 0.4
75 0.37
76 0.33
77 0.31
78 0.27
79 0.2
80 0.18
81 0.08
82 0.06
83 0.06
84 0.05
85 0.05
86 0.06
87 0.07
88 0.07
89 0.08
90 0.09
91 0.1
92 0.11
93 0.12
94 0.13
95 0.17
96 0.17
97 0.16
98 0.15
99 0.14
100 0.13
101 0.12
102 0.13
103 0.12
104 0.14
105 0.17
106 0.19
107 0.23
108 0.26
109 0.28
110 0.27
111 0.26
112 0.24
113 0.23
114 0.22
115 0.18
116 0.17
117 0.14
118 0.13
119 0.1
120 0.1
121 0.09
122 0.09
123 0.09
124 0.11
125 0.14
126 0.16
127 0.17
128 0.18
129 0.19
130 0.19
131 0.18
132 0.14
133 0.17
134 0.16
135 0.17
136 0.18
137 0.2
138 0.24
139 0.26
140 0.25
141 0.21
142 0.2
143 0.18
144 0.19
145 0.19
146 0.16
147 0.15
148 0.15
149 0.15
150 0.2
151 0.21
152 0.2
153 0.23
154 0.24
155 0.27
156 0.35
157 0.41
158 0.41
159 0.45
160 0.49
161 0.54
162 0.58
163 0.57
164 0.51
165 0.46
166 0.42
167 0.4
168 0.35
169 0.26
170 0.21
171 0.2
172 0.19
173 0.18
174 0.16
175 0.14
176 0.12
177 0.14
178 0.12
179 0.11
180 0.11