Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139ADT3

Protein Details
Accession A0A139ADT3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
118-139PSEVESRHARHRGKRDPSRKCRBasic
NLS Segment(s)
PositionSequence
124-137RHARHRGKRDPSRK
Subcellular Location(s) mito 23, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025800  CaM-Lys-N-MeTrfase  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0018025  F:calmodulin-lysine N-methyltransferase activity  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
Amino Acid Sequences MQRRRNPFRGRTGGAGGARVIELGAGTGLLGLVVPRTFPVAEVVLTDKLGSLDLLRFNAEKNCVDAWRDGKVRMDELMWGAEKRAQELGTFDVIVVADCVSFSERRGPEAEGANQAKPSEVESRHARHRGKRDPSRKCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.45
3 0.35
4 0.27
5 0.22
6 0.17
7 0.13
8 0.06
9 0.05
10 0.04
11 0.04
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.02
19 0.03
20 0.03
21 0.04
22 0.04
23 0.06
24 0.06
25 0.07
26 0.09
27 0.09
28 0.09
29 0.1
30 0.12
31 0.11
32 0.11
33 0.11
34 0.09
35 0.08
36 0.08
37 0.07
38 0.05
39 0.07
40 0.08
41 0.08
42 0.09
43 0.09
44 0.1
45 0.12
46 0.14
47 0.12
48 0.14
49 0.14
50 0.14
51 0.15
52 0.17
53 0.16
54 0.19
55 0.2
56 0.18
57 0.2
58 0.2
59 0.2
60 0.18
61 0.16
62 0.12
63 0.11
64 0.12
65 0.09
66 0.09
67 0.08
68 0.1
69 0.1
70 0.11
71 0.12
72 0.1
73 0.1
74 0.11
75 0.13
76 0.12
77 0.12
78 0.1
79 0.09
80 0.09
81 0.08
82 0.07
83 0.05
84 0.04
85 0.04
86 0.05
87 0.06
88 0.06
89 0.07
90 0.16
91 0.16
92 0.18
93 0.21
94 0.22
95 0.24
96 0.28
97 0.3
98 0.3
99 0.32
100 0.31
101 0.31
102 0.29
103 0.26
104 0.22
105 0.22
106 0.22
107 0.21
108 0.26
109 0.32
110 0.38
111 0.46
112 0.54
113 0.58
114 0.59
115 0.68
116 0.72
117 0.76
118 0.81
119 0.83