Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AEC0

Protein Details
Accession A0A139AEC0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-111ISSRSVEYPHCRRRRRVPDQKDIMASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035899  DBL_dom_sf  
IPR000219  DH-domain  
Gene Ontology GO:0005085  F:guanyl-nucleotide exchange factor activity  
Pfam View protein in Pfam  
PF00621  RhoGEF  
PROSITE View protein in PROSITE  
PS50010  DH_2  
Amino Acid Sequences MKKTAASQRASPSPTLVESNFSTFEPEPDEGDSTEFEVTNDGIEAVLTESAETYPAHTDFSEAEEWIRRSLQPEEESVESDGASTISSRSVEYPHCRRRRRVPDQKDIMASNWRDSVPSHVTDGLPPSEMVRQEAIFELVKIQCEFAADLRNMCKYIETLRQADTMDPHRLQAFIRVAFANMDGDMMHENAALAELLKKRQKERPIVEHVGDVLLSKTGIKALRSFAQYGKNQFYSQWWVKNEKSQNPAFATFVEAQSRLPQYRRLPLEAFITRPSTHLGRLPLLADVILQRTPADSPDQLDLQAYMRQCRSVLKQIDSEVAKVNTTSTQRLAQPAEQRVPSSAPAPATTTRAGGESRLRFAVFRSPTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.3
4 0.27
5 0.26
6 0.28
7 0.27
8 0.24
9 0.27
10 0.23
11 0.24
12 0.24
13 0.23
14 0.21
15 0.22
16 0.24
17 0.19
18 0.2
19 0.19
20 0.16
21 0.16
22 0.15
23 0.12
24 0.12
25 0.11
26 0.1
27 0.1
28 0.08
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.06
37 0.06
38 0.08
39 0.07
40 0.08
41 0.11
42 0.12
43 0.13
44 0.12
45 0.14
46 0.13
47 0.17
48 0.17
49 0.13
50 0.15
51 0.19
52 0.21
53 0.21
54 0.22
55 0.19
56 0.21
57 0.25
58 0.3
59 0.26
60 0.28
61 0.29
62 0.29
63 0.3
64 0.28
65 0.24
66 0.16
67 0.15
68 0.13
69 0.09
70 0.08
71 0.06
72 0.05
73 0.07
74 0.08
75 0.08
76 0.09
77 0.12
78 0.18
79 0.26
80 0.36
81 0.45
82 0.55
83 0.61
84 0.67
85 0.75
86 0.8
87 0.83
88 0.84
89 0.83
90 0.85
91 0.85
92 0.82
93 0.75
94 0.65
95 0.56
96 0.52
97 0.43
98 0.34
99 0.29
100 0.24
101 0.21
102 0.2
103 0.25
104 0.21
105 0.21
106 0.21
107 0.2
108 0.2
109 0.21
110 0.23
111 0.17
112 0.14
113 0.13
114 0.12
115 0.14
116 0.14
117 0.14
118 0.13
119 0.12
120 0.12
121 0.13
122 0.14
123 0.11
124 0.1
125 0.12
126 0.11
127 0.12
128 0.12
129 0.11
130 0.09
131 0.1
132 0.1
133 0.09
134 0.13
135 0.11
136 0.13
137 0.14
138 0.15
139 0.15
140 0.14
141 0.14
142 0.1
143 0.14
144 0.19
145 0.22
146 0.22
147 0.23
148 0.25
149 0.25
150 0.24
151 0.23
152 0.2
153 0.21
154 0.2
155 0.19
156 0.18
157 0.18
158 0.17
159 0.2
160 0.19
161 0.15
162 0.16
163 0.16
164 0.15
165 0.15
166 0.15
167 0.09
168 0.06
169 0.06
170 0.04
171 0.05
172 0.05
173 0.05
174 0.05
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.03
181 0.06
182 0.08
183 0.12
184 0.15
185 0.18
186 0.21
187 0.28
188 0.35
189 0.41
190 0.47
191 0.52
192 0.57
193 0.59
194 0.56
195 0.5
196 0.43
197 0.33
198 0.26
199 0.18
200 0.09
201 0.06
202 0.05
203 0.04
204 0.04
205 0.07
206 0.09
207 0.09
208 0.11
209 0.13
210 0.18
211 0.2
212 0.22
213 0.22
214 0.28
215 0.31
216 0.33
217 0.35
218 0.33
219 0.31
220 0.3
221 0.3
222 0.31
223 0.32
224 0.34
225 0.32
226 0.36
227 0.37
228 0.45
229 0.49
230 0.47
231 0.49
232 0.45
233 0.47
234 0.45
235 0.45
236 0.37
237 0.3
238 0.27
239 0.23
240 0.22
241 0.19
242 0.16
243 0.15
244 0.19
245 0.22
246 0.2
247 0.21
248 0.27
249 0.29
250 0.37
251 0.4
252 0.4
253 0.38
254 0.38
255 0.44
256 0.38
257 0.36
258 0.3
259 0.3
260 0.26
261 0.25
262 0.27
263 0.21
264 0.21
265 0.23
266 0.23
267 0.21
268 0.22
269 0.22
270 0.19
271 0.17
272 0.15
273 0.12
274 0.1
275 0.1
276 0.1
277 0.09
278 0.09
279 0.09
280 0.1
281 0.11
282 0.14
283 0.13
284 0.15
285 0.18
286 0.18
287 0.18
288 0.18
289 0.17
290 0.15
291 0.17
292 0.17
293 0.18
294 0.18
295 0.19
296 0.2
297 0.24
298 0.28
299 0.35
300 0.4
301 0.39
302 0.42
303 0.43
304 0.49
305 0.45
306 0.4
307 0.36
308 0.31
309 0.27
310 0.24
311 0.23
312 0.22
313 0.24
314 0.25
315 0.23
316 0.26
317 0.28
318 0.34
319 0.36
320 0.37
321 0.42
322 0.46
323 0.5
324 0.47
325 0.46
326 0.43
327 0.41
328 0.37
329 0.31
330 0.26
331 0.22
332 0.21
333 0.24
334 0.24
335 0.26
336 0.25
337 0.24
338 0.22
339 0.22
340 0.21
341 0.22
342 0.28
343 0.28
344 0.31
345 0.32
346 0.32
347 0.3
348 0.32
349 0.38