Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139ACC3

Protein Details
Accession A0A139ACC3    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
268-287TYSQRPSRKKARVESLRPFFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 10, cyto 7, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037473  Lcp-like  
IPR018713  MPAB/Lcp_cat_dom  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF09995  MPAB_Lcp_cat  
Amino Acid Sequences MAPRDAKKELGERVMYQVAGPKDRKLTSRFPRTPLAELRELSLSGDETVDAYLSNTYHPKRDDVLDKLRKYVGRGHPQARVLWNEINTIPSWVEPERVKRGQEVFYRTGSPDFSKVFFATGYLANPSKQSFTRLVETIHWVVNIMADKRLGPGSESWEATIRVRFLHAAVRQRLKEKWTSEEVVIPINQESRTARRSSPSAYIGYLMGIPDKWNPLRNGVDWATSFHTDVVAHLLSPDDHAVRVSNAVLGGAAIGPPDMIEKLRPTFTYSQRPSRKKARVESLRPFFSKILTHLARIVNGDESRSLTNVNKITKVLFSGLVMETRILYLTPLTRGPAAGIRKEFYTRICPWYLGDKPSFRLKHDPAEAIAAPVVVVGVRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.39
3 0.32
4 0.33
5 0.3
6 0.34
7 0.34
8 0.33
9 0.38
10 0.41
11 0.46
12 0.46
13 0.53
14 0.55
15 0.65
16 0.66
17 0.64
18 0.7
19 0.68
20 0.69
21 0.67
22 0.63
23 0.57
24 0.52
25 0.49
26 0.42
27 0.38
28 0.32
29 0.25
30 0.19
31 0.13
32 0.13
33 0.1
34 0.09
35 0.09
36 0.08
37 0.07
38 0.06
39 0.07
40 0.07
41 0.1
42 0.17
43 0.18
44 0.24
45 0.26
46 0.28
47 0.3
48 0.36
49 0.4
50 0.41
51 0.5
52 0.54
53 0.54
54 0.54
55 0.55
56 0.51
57 0.47
58 0.49
59 0.48
60 0.49
61 0.56
62 0.57
63 0.58
64 0.59
65 0.61
66 0.55
67 0.48
68 0.42
69 0.38
70 0.35
71 0.31
72 0.29
73 0.27
74 0.23
75 0.2
76 0.16
77 0.12
78 0.15
79 0.13
80 0.16
81 0.18
82 0.24
83 0.31
84 0.34
85 0.35
86 0.37
87 0.41
88 0.43
89 0.47
90 0.48
91 0.42
92 0.41
93 0.42
94 0.38
95 0.35
96 0.3
97 0.26
98 0.22
99 0.21
100 0.2
101 0.2
102 0.19
103 0.18
104 0.16
105 0.15
106 0.13
107 0.12
108 0.11
109 0.12
110 0.13
111 0.13
112 0.14
113 0.14
114 0.15
115 0.15
116 0.18
117 0.19
118 0.22
119 0.25
120 0.25
121 0.26
122 0.25
123 0.28
124 0.26
125 0.23
126 0.19
127 0.16
128 0.14
129 0.15
130 0.16
131 0.12
132 0.11
133 0.1
134 0.11
135 0.12
136 0.12
137 0.1
138 0.09
139 0.1
140 0.14
141 0.17
142 0.17
143 0.16
144 0.17
145 0.18
146 0.18
147 0.18
148 0.14
149 0.11
150 0.11
151 0.11
152 0.1
153 0.15
154 0.18
155 0.24
156 0.29
157 0.34
158 0.35
159 0.37
160 0.39
161 0.35
162 0.38
163 0.32
164 0.32
165 0.31
166 0.32
167 0.29
168 0.3
169 0.27
170 0.22
171 0.2
172 0.16
173 0.12
174 0.12
175 0.11
176 0.1
177 0.11
178 0.13
179 0.15
180 0.17
181 0.18
182 0.19
183 0.21
184 0.22
185 0.25
186 0.24
187 0.23
188 0.2
189 0.2
190 0.18
191 0.16
192 0.14
193 0.09
194 0.07
195 0.06
196 0.06
197 0.07
198 0.1
199 0.11
200 0.15
201 0.16
202 0.2
203 0.23
204 0.23
205 0.27
206 0.24
207 0.25
208 0.21
209 0.22
210 0.2
211 0.19
212 0.18
213 0.13
214 0.13
215 0.11
216 0.1
217 0.11
218 0.09
219 0.08
220 0.07
221 0.08
222 0.07
223 0.08
224 0.09
225 0.06
226 0.06
227 0.07
228 0.07
229 0.07
230 0.08
231 0.08
232 0.07
233 0.07
234 0.06
235 0.06
236 0.05
237 0.05
238 0.04
239 0.04
240 0.03
241 0.03
242 0.03
243 0.03
244 0.04
245 0.04
246 0.05
247 0.06
248 0.09
249 0.12
250 0.14
251 0.15
252 0.19
253 0.26
254 0.32
255 0.42
256 0.45
257 0.53
258 0.61
259 0.66
260 0.68
261 0.71
262 0.74
263 0.71
264 0.74
265 0.75
266 0.75
267 0.79
268 0.82
269 0.8
270 0.77
271 0.7
272 0.64
273 0.54
274 0.46
275 0.39
276 0.31
277 0.32
278 0.27
279 0.27
280 0.29
281 0.3
282 0.29
283 0.28
284 0.26
285 0.22
286 0.21
287 0.21
288 0.17
289 0.18
290 0.18
291 0.17
292 0.18
293 0.15
294 0.21
295 0.26
296 0.28
297 0.28
298 0.27
299 0.28
300 0.27
301 0.27
302 0.23
303 0.18
304 0.15
305 0.17
306 0.17
307 0.16
308 0.15
309 0.14
310 0.12
311 0.11
312 0.11
313 0.08
314 0.07
315 0.09
316 0.1
317 0.13
318 0.14
319 0.15
320 0.16
321 0.16
322 0.17
323 0.22
324 0.25
325 0.28
326 0.3
327 0.3
328 0.32
329 0.35
330 0.35
331 0.33
332 0.36
333 0.34
334 0.37
335 0.37
336 0.36
337 0.35
338 0.42
339 0.43
340 0.42
341 0.44
342 0.42
343 0.44
344 0.53
345 0.53
346 0.49
347 0.54
348 0.52
349 0.55
350 0.57
351 0.57
352 0.48
353 0.51
354 0.47
355 0.38
356 0.34
357 0.24
358 0.17
359 0.14
360 0.12