Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AXX0

Protein Details
Accession A0A139AXX0   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
206-237RLTISRARKLRRARRVAFRKARQERKVREIKSBasic
NLS Segment(s)
PositionSequence
180-249PLNKKKGSARANILPKLPRPERLAEHRLTISRARKLRRARRVAFRKARQERKVREIKSGGRKRELPKVKG
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MKTLRTRSSTSAGVFLRAGPQSRAVCSLCILSPLKTPRLSSQNRLANPPSSSSTPLPTNTPFLRPLTSVPGTHREPLPSHRIPRFTIEYSALDKPFIGKAKVKASKFIPKPTSSIPDHETFLNRIGRDCAQFSSKFNSWDAFWTASSAQMEEMGIPPKSRKYILSWKDNFRSGIALRPIPLNKKKGSARANILPKLPRPERLAEHRLTISRARKLRRARRVAFRKARQERKVREIKSGGRKRELPKVKGLERLVIVRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.28
4 0.26
5 0.27
6 0.21
7 0.27
8 0.27
9 0.28
10 0.33
11 0.28
12 0.27
13 0.25
14 0.26
15 0.19
16 0.23
17 0.22
18 0.19
19 0.25
20 0.29
21 0.33
22 0.33
23 0.35
24 0.37
25 0.46
26 0.5
27 0.49
28 0.54
29 0.57
30 0.57
31 0.6
32 0.56
33 0.51
34 0.47
35 0.44
36 0.38
37 0.32
38 0.34
39 0.3
40 0.31
41 0.3
42 0.3
43 0.3
44 0.28
45 0.31
46 0.29
47 0.3
48 0.29
49 0.27
50 0.28
51 0.25
52 0.25
53 0.27
54 0.27
55 0.26
56 0.26
57 0.31
58 0.31
59 0.33
60 0.33
61 0.28
62 0.28
63 0.32
64 0.37
65 0.36
66 0.4
67 0.41
68 0.43
69 0.42
70 0.45
71 0.46
72 0.39
73 0.36
74 0.32
75 0.3
76 0.31
77 0.32
78 0.27
79 0.21
80 0.19
81 0.18
82 0.19
83 0.19
84 0.17
85 0.17
86 0.22
87 0.31
88 0.38
89 0.37
90 0.38
91 0.41
92 0.48
93 0.48
94 0.52
95 0.48
96 0.42
97 0.45
98 0.43
99 0.45
100 0.37
101 0.36
102 0.31
103 0.28
104 0.27
105 0.25
106 0.24
107 0.19
108 0.21
109 0.21
110 0.18
111 0.16
112 0.17
113 0.18
114 0.18
115 0.18
116 0.15
117 0.15
118 0.16
119 0.17
120 0.21
121 0.21
122 0.21
123 0.21
124 0.2
125 0.17
126 0.19
127 0.2
128 0.15
129 0.13
130 0.13
131 0.13
132 0.14
133 0.13
134 0.11
135 0.09
136 0.08
137 0.08
138 0.07
139 0.08
140 0.08
141 0.09
142 0.09
143 0.1
144 0.12
145 0.14
146 0.15
147 0.15
148 0.2
149 0.3
150 0.37
151 0.46
152 0.5
153 0.55
154 0.58
155 0.59
156 0.53
157 0.43
158 0.4
159 0.3
160 0.31
161 0.27
162 0.24
163 0.22
164 0.26
165 0.28
166 0.33
167 0.39
168 0.38
169 0.36
170 0.43
171 0.46
172 0.51
173 0.55
174 0.53
175 0.53
176 0.56
177 0.62
178 0.58
179 0.58
180 0.53
181 0.5
182 0.53
183 0.48
184 0.45
185 0.42
186 0.44
187 0.46
188 0.51
189 0.54
190 0.47
191 0.49
192 0.46
193 0.43
194 0.41
195 0.42
196 0.4
197 0.42
198 0.47
199 0.48
200 0.53
201 0.63
202 0.7
203 0.73
204 0.77
205 0.76
206 0.81
207 0.86
208 0.88
209 0.88
210 0.87
211 0.87
212 0.88
213 0.9
214 0.88
215 0.89
216 0.86
217 0.86
218 0.87
219 0.78
220 0.76
221 0.74
222 0.74
223 0.75
224 0.76
225 0.73
226 0.7
227 0.76
228 0.71
229 0.74
230 0.75
231 0.68
232 0.69
233 0.71
234 0.68
235 0.69
236 0.66
237 0.61
238 0.54