Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AZS4

Protein Details
Accession A0A139AZS4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
23-43AVFFICKRRERARRIRQDGGSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, plas 4, cyto 3, E.R. 3, mito 2, cyto_nucl 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTPGIVVGLMSAGVVLGLTLAAAVFFICKRRERARRIRQDGGSAPQVVVVVENGSGSLPPPYEKPPVSPPPRGDSKLASVEKEGDLMTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.03
12 0.04
13 0.08
14 0.11
15 0.15
16 0.21
17 0.31
18 0.4
19 0.49
20 0.6
21 0.67
22 0.75
23 0.8
24 0.82
25 0.73
26 0.69
27 0.62
28 0.54
29 0.46
30 0.35
31 0.27
32 0.2
33 0.18
34 0.13
35 0.1
36 0.07
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.06
47 0.08
48 0.12
49 0.18
50 0.19
51 0.22
52 0.3
53 0.4
54 0.45
55 0.5
56 0.5
57 0.51
58 0.58
59 0.57
60 0.51
61 0.45
62 0.45
63 0.48
64 0.46
65 0.41
66 0.35
67 0.35
68 0.33
69 0.3