Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A138ZZF7

Protein Details
Accession A0A138ZZF7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
371-408ETTRTSVVKTPKTKKTKKTKKTKGPKKTKATTPAPPGTHydrophilic
NLS Segment(s)
PositionSequence
380-399TPKTKKTKKTKKTKGPKKTK
Subcellular Location(s) extr 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR002861  Reeler_dom  
IPR042307  Reeler_sf  
Pfam View protein in Pfam  
PF02014  Reeler  
Amino Acid Sequences MVTVLSLLAALPLVSMSLAFPQGDAPVCSYQDTMQDALQAVHGNASVPVATLKVSQTGNSYSITLDGIEQYNGLVLYVRPSANSTHVGTFDFTGLADVGLRGKDCRCLSGTTSGNLSTIGHFEGKEKTKTSFLWTPDAAVKGGMQLVAEAVVVMSEKKWFLATPGSFVASEPSSTSPVGRPVSSPAPPSASATPVTSSSPASSSPTAAPVSAPISAPPPNPTFAPVSAPGSPTASAPASAPTPDGTPDGSDCGPDNGDSVTFDPAPGPTSTSPEPTPDWSYPVSADDSDSDCVTDSTDGTISSAPATGPTFIALPILPDSTSSASPALPSAGSSANITQPSPANPAAPDVTTPAGSPTAPVVPPSGGGFVETTRTSVVKTPKTKKTKKTKKTKGPKKTKATTPAPPGTQTSVAPGSCGGTPTPAAGNGGGAGETSSASLGCGPVTATTTGANGFGGVAQPTDGPKNYAVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.07
5 0.09
6 0.08
7 0.09
8 0.1
9 0.12
10 0.14
11 0.14
12 0.16
13 0.18
14 0.19
15 0.2
16 0.21
17 0.19
18 0.22
19 0.24
20 0.22
21 0.19
22 0.2
23 0.2
24 0.19
25 0.2
26 0.16
27 0.13
28 0.13
29 0.13
30 0.11
31 0.1
32 0.1
33 0.08
34 0.08
35 0.08
36 0.07
37 0.08
38 0.09
39 0.1
40 0.14
41 0.15
42 0.15
43 0.18
44 0.21
45 0.22
46 0.21
47 0.21
48 0.16
49 0.16
50 0.16
51 0.12
52 0.1
53 0.11
54 0.11
55 0.11
56 0.1
57 0.09
58 0.1
59 0.09
60 0.09
61 0.07
62 0.06
63 0.09
64 0.12
65 0.13
66 0.12
67 0.14
68 0.16
69 0.18
70 0.22
71 0.22
72 0.21
73 0.22
74 0.22
75 0.22
76 0.21
77 0.18
78 0.14
79 0.11
80 0.1
81 0.09
82 0.08
83 0.07
84 0.06
85 0.07
86 0.08
87 0.08
88 0.09
89 0.1
90 0.18
91 0.18
92 0.21
93 0.21
94 0.24
95 0.26
96 0.33
97 0.35
98 0.29
99 0.3
100 0.27
101 0.25
102 0.22
103 0.2
104 0.12
105 0.11
106 0.11
107 0.1
108 0.1
109 0.12
110 0.19
111 0.23
112 0.26
113 0.27
114 0.27
115 0.3
116 0.3
117 0.36
118 0.35
119 0.33
120 0.35
121 0.33
122 0.33
123 0.33
124 0.33
125 0.26
126 0.2
127 0.17
128 0.12
129 0.12
130 0.1
131 0.07
132 0.06
133 0.05
134 0.05
135 0.05
136 0.04
137 0.03
138 0.03
139 0.03
140 0.03
141 0.04
142 0.05
143 0.05
144 0.05
145 0.06
146 0.06
147 0.08
148 0.16
149 0.16
150 0.18
151 0.19
152 0.2
153 0.19
154 0.19
155 0.2
156 0.12
157 0.12
158 0.1
159 0.11
160 0.11
161 0.12
162 0.13
163 0.12
164 0.17
165 0.18
166 0.17
167 0.17
168 0.19
169 0.23
170 0.24
171 0.24
172 0.2
173 0.21
174 0.21
175 0.24
176 0.2
177 0.18
178 0.17
179 0.16
180 0.16
181 0.13
182 0.14
183 0.12
184 0.11
185 0.1
186 0.1
187 0.1
188 0.12
189 0.12
190 0.13
191 0.12
192 0.14
193 0.14
194 0.13
195 0.12
196 0.1
197 0.11
198 0.1
199 0.1
200 0.07
201 0.1
202 0.11
203 0.12
204 0.14
205 0.14
206 0.15
207 0.15
208 0.16
209 0.16
210 0.15
211 0.17
212 0.15
213 0.16
214 0.16
215 0.16
216 0.15
217 0.14
218 0.14
219 0.11
220 0.11
221 0.09
222 0.08
223 0.08
224 0.08
225 0.08
226 0.08
227 0.08
228 0.07
229 0.07
230 0.08
231 0.08
232 0.07
233 0.07
234 0.07
235 0.09
236 0.09
237 0.09
238 0.08
239 0.09
240 0.09
241 0.08
242 0.08
243 0.06
244 0.06
245 0.06
246 0.07
247 0.08
248 0.08
249 0.08
250 0.08
251 0.08
252 0.09
253 0.09
254 0.11
255 0.09
256 0.14
257 0.15
258 0.17
259 0.17
260 0.18
261 0.19
262 0.2
263 0.24
264 0.2
265 0.22
266 0.2
267 0.2
268 0.18
269 0.18
270 0.17
271 0.12
272 0.12
273 0.11
274 0.12
275 0.13
276 0.12
277 0.11
278 0.09
279 0.09
280 0.09
281 0.08
282 0.06
283 0.06
284 0.07
285 0.07
286 0.07
287 0.07
288 0.07
289 0.07
290 0.07
291 0.06
292 0.07
293 0.08
294 0.07
295 0.07
296 0.08
297 0.08
298 0.07
299 0.08
300 0.06
301 0.07
302 0.07
303 0.08
304 0.07
305 0.07
306 0.09
307 0.11
308 0.11
309 0.11
310 0.11
311 0.1
312 0.1
313 0.11
314 0.09
315 0.07
316 0.07
317 0.08
318 0.09
319 0.09
320 0.1
321 0.11
322 0.14
323 0.15
324 0.14
325 0.14
326 0.15
327 0.16
328 0.2
329 0.19
330 0.17
331 0.16
332 0.19
333 0.18
334 0.17
335 0.16
336 0.13
337 0.14
338 0.13
339 0.13
340 0.12
341 0.11
342 0.11
343 0.11
344 0.1
345 0.13
346 0.12
347 0.13
348 0.13
349 0.12
350 0.13
351 0.14
352 0.13
353 0.1
354 0.1
355 0.1
356 0.09
357 0.12
358 0.12
359 0.12
360 0.12
361 0.12
362 0.12
363 0.18
364 0.26
365 0.31
366 0.41
367 0.49
368 0.58
369 0.69
370 0.77
371 0.82
372 0.85
373 0.87
374 0.88
375 0.91
376 0.92
377 0.92
378 0.94
379 0.95
380 0.95
381 0.95
382 0.95
383 0.94
384 0.92
385 0.9
386 0.89
387 0.85
388 0.83
389 0.81
390 0.77
391 0.69
392 0.63
393 0.56
394 0.51
395 0.45
396 0.37
397 0.32
398 0.29
399 0.27
400 0.25
401 0.22
402 0.19
403 0.17
404 0.19
405 0.14
406 0.11
407 0.12
408 0.13
409 0.14
410 0.13
411 0.14
412 0.13
413 0.13
414 0.11
415 0.11
416 0.09
417 0.07
418 0.07
419 0.06
420 0.06
421 0.06
422 0.06
423 0.05
424 0.06
425 0.06
426 0.07
427 0.06
428 0.06
429 0.07
430 0.08
431 0.1
432 0.11
433 0.11
434 0.11
435 0.12
436 0.12
437 0.12
438 0.11
439 0.09
440 0.08
441 0.08
442 0.09
443 0.08
444 0.08
445 0.08
446 0.09
447 0.12
448 0.17
449 0.18
450 0.19