Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AM81

Protein Details
Accession A0A139AM81    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
129-162GQFKRWPSGGHHNKRKLRIKARRLKRKATLVSHABasic
NLS Segment(s)
PositionSequence
108-156GKKYKLKTHSGAKKRFKPIANGQFKRWPSGGHHNKRKLRIKARRLKRKA
Subcellular Location(s) mito 19, nucl 5, cyto 1, plas 1, extr 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR021137  Ribosomal_L35  
IPR018265  Ribosomal_L35_CS  
IPR037229  Ribosomal_L35_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01632  Ribosomal_L35p  
PROSITE View protein in PROSITE  
PS00936  RIBOSOMAL_L35  
Amino Acid Sequences MTPFTAAISSARTSCVLHRGPLFAPVLSLARGASGAGGGSTHVQFGRAREGRSWQAQAQTRELATVARCGQGMDTGGVMGSNMVSRWQQQHLATSPQKSQSRGVAIFGKKYKLKTHSGAKKRFKPIANGQFKRWPSGGHHNKRKLRIKARRLKRKATLVSHAWQKKMLRRLMPYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.26
3 0.24
4 0.27
5 0.28
6 0.3
7 0.29
8 0.33
9 0.32
10 0.23
11 0.21
12 0.19
13 0.18
14 0.15
15 0.15
16 0.09
17 0.08
18 0.08
19 0.08
20 0.06
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.06
27 0.06
28 0.07
29 0.07
30 0.09
31 0.1
32 0.12
33 0.21
34 0.23
35 0.24
36 0.25
37 0.3
38 0.33
39 0.36
40 0.38
41 0.3
42 0.34
43 0.39
44 0.4
45 0.38
46 0.34
47 0.3
48 0.27
49 0.25
50 0.19
51 0.14
52 0.15
53 0.13
54 0.12
55 0.12
56 0.12
57 0.11
58 0.11
59 0.11
60 0.08
61 0.07
62 0.06
63 0.05
64 0.05
65 0.05
66 0.04
67 0.03
68 0.03
69 0.03
70 0.04
71 0.04
72 0.06
73 0.08
74 0.1
75 0.13
76 0.13
77 0.17
78 0.18
79 0.25
80 0.27
81 0.27
82 0.28
83 0.32
84 0.34
85 0.32
86 0.32
87 0.28
88 0.31
89 0.29
90 0.29
91 0.29
92 0.27
93 0.31
94 0.31
95 0.32
96 0.29
97 0.32
98 0.36
99 0.34
100 0.38
101 0.4
102 0.48
103 0.54
104 0.61
105 0.69
106 0.72
107 0.76
108 0.78
109 0.79
110 0.71
111 0.69
112 0.7
113 0.71
114 0.73
115 0.66
116 0.63
117 0.65
118 0.62
119 0.59
120 0.48
121 0.4
122 0.36
123 0.44
124 0.51
125 0.53
126 0.63
127 0.68
128 0.75
129 0.82
130 0.85
131 0.84
132 0.84
133 0.85
134 0.85
135 0.86
136 0.9
137 0.92
138 0.9
139 0.89
140 0.87
141 0.87
142 0.85
143 0.81
144 0.78
145 0.73
146 0.72
147 0.72
148 0.68
149 0.59
150 0.56
151 0.54
152 0.55
153 0.58
154 0.58
155 0.56