Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139A3I5

Protein Details
Accession A0A139A3I5   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-37ICVRQIKYVHVKRKHHFRSKNTFGKHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
Amino Acid Sequences MFCRAVSEGEMICVRQIKYVHVKRKHHFRSKNTFGKHAGCILSTTRERRTSYMGYIHTHAHTHMEFDLSCIRKVIQKSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.19
4 0.22
5 0.32
6 0.41
7 0.49
8 0.55
9 0.63
10 0.66
11 0.76
12 0.81
13 0.81
14 0.81
15 0.8
16 0.81
17 0.82
18 0.84
19 0.75
20 0.69
21 0.62
22 0.56
23 0.48
24 0.41
25 0.31
26 0.22
27 0.21
28 0.17
29 0.18
30 0.18
31 0.21
32 0.22
33 0.26
34 0.28
35 0.28
36 0.33
37 0.31
38 0.31
39 0.34
40 0.32
41 0.3
42 0.3
43 0.31
44 0.27
45 0.25
46 0.22
47 0.2
48 0.17
49 0.17
50 0.15
51 0.15
52 0.14
53 0.16
54 0.23
55 0.21
56 0.22
57 0.21
58 0.22
59 0.25