Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139A1V8

Protein Details
Accession A0A139A1V8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
95-121PCLQRGKTLKGSKSRNRNPRETSKVRWHydrophilic
NLS Segment(s)
PositionSequence
107-109KSR
Subcellular Location(s) nucl 11, cyto_nucl 10.833, cyto 8.5, cyto_mito 8.166, mito 6.5
Family & Domain DBs
Amino Acid Sequences MKTVQVQELKNFLVGVPESTDAAPPPGGPTSPVISSAAASGTSIPPVLEMIPACRWGIGAVFRLSWRQGDDERKNPPVRQNSRFRLCHEATKTIPCLQRGKTLKGSKSRNRNPRETSKVRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.14
4 0.14
5 0.15
6 0.15
7 0.16
8 0.12
9 0.13
10 0.12
11 0.09
12 0.11
13 0.11
14 0.11
15 0.11
16 0.13
17 0.14
18 0.14
19 0.16
20 0.14
21 0.13
22 0.14
23 0.13
24 0.11
25 0.08
26 0.07
27 0.07
28 0.06
29 0.06
30 0.06
31 0.06
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.08
38 0.09
39 0.1
40 0.1
41 0.09
42 0.09
43 0.08
44 0.09
45 0.08
46 0.09
47 0.09
48 0.09
49 0.1
50 0.11
51 0.11
52 0.11
53 0.1
54 0.11
55 0.15
56 0.24
57 0.29
58 0.34
59 0.38
60 0.44
61 0.46
62 0.46
63 0.5
64 0.51
65 0.53
66 0.56
67 0.61
68 0.63
69 0.69
70 0.69
71 0.65
72 0.64
73 0.58
74 0.59
75 0.53
76 0.5
77 0.43
78 0.46
79 0.45
80 0.43
81 0.44
82 0.4
83 0.41
84 0.38
85 0.45
86 0.45
87 0.49
88 0.52
89 0.56
90 0.6
91 0.64
92 0.72
93 0.71
94 0.77
95 0.81
96 0.81
97 0.81
98 0.84
99 0.83
100 0.83
101 0.84