Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139APP1

Protein Details
Accession A0A139APP1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
21-42TPPPPHTKPAHRHRPHPRAPLABasic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 6, plas 6, pero 2, extr 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MVDDRPSAAIPLLHRNPFPPTPPPPHTKPAHRHRPHPRAPLALLTLVFLLIACRNIHPSLAALQDGSFGFGRWYYESLELDKTGFYVGKPVSVVRPRVGSGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.37
4 0.38
5 0.39
6 0.36
7 0.37
8 0.43
9 0.49
10 0.53
11 0.52
12 0.58
13 0.6
14 0.62
15 0.65
16 0.67
17 0.73
18 0.71
19 0.75
20 0.78
21 0.83
22 0.82
23 0.8
24 0.73
25 0.66
26 0.63
27 0.56
28 0.46
29 0.37
30 0.28
31 0.19
32 0.15
33 0.11
34 0.09
35 0.06
36 0.05
37 0.04
38 0.05
39 0.05
40 0.05
41 0.08
42 0.08
43 0.09
44 0.08
45 0.09
46 0.1
47 0.1
48 0.1
49 0.08
50 0.08
51 0.1
52 0.09
53 0.1
54 0.08
55 0.07
56 0.08
57 0.08
58 0.1
59 0.1
60 0.11
61 0.11
62 0.14
63 0.15
64 0.17
65 0.19
66 0.17
67 0.17
68 0.15
69 0.13
70 0.12
71 0.11
72 0.09
73 0.13
74 0.13
75 0.15
76 0.16
77 0.17
78 0.24
79 0.3
80 0.34
81 0.31
82 0.34