Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139A7Y5

Protein Details
Accession A0A139A7Y5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
204-223KRAAKIAKLRREIRRLRTEKBasic
NLS Segment(s)
PositionSequence
204-220KRAAKIAKLRREIRRLR
Subcellular Location(s) cyto 15, nucl 7, mito 3
Family & Domain DBs
Amino Acid Sequences MESNSNLCLFLVKEAFDEEVEAAGDRQGQGQAGGLAGERTAQHAVPQAVAPMVVQGGGLTARQAVGARPGAGFADWNEDVACTLQVVGCGRGRVSANPAFTSNTLPHSTLPRPSPSPSSRRSLPSSPQRARLPPVPPTTPRSTAPHASPVQMPTADDDARRKCEDIMPKIIAVETAHLCLVAGAWVSRNSNTNAPNDPGQENAKRAAKIAKLRREIRRLRTEKGVLWEHLDGVQAAQGGDESGGKDLVRLSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.15
4 0.16
5 0.12
6 0.11
7 0.1
8 0.1
9 0.09
10 0.08
11 0.1
12 0.09
13 0.1
14 0.1
15 0.1
16 0.09
17 0.1
18 0.1
19 0.09
20 0.09
21 0.07
22 0.07
23 0.06
24 0.07
25 0.06
26 0.09
27 0.1
28 0.1
29 0.11
30 0.17
31 0.17
32 0.17
33 0.17
34 0.15
35 0.14
36 0.14
37 0.12
38 0.07
39 0.06
40 0.05
41 0.05
42 0.04
43 0.04
44 0.04
45 0.05
46 0.04
47 0.04
48 0.05
49 0.05
50 0.06
51 0.06
52 0.1
53 0.11
54 0.12
55 0.12
56 0.12
57 0.12
58 0.11
59 0.12
60 0.08
61 0.12
62 0.12
63 0.12
64 0.12
65 0.11
66 0.12
67 0.12
68 0.11
69 0.05
70 0.05
71 0.05
72 0.06
73 0.07
74 0.09
75 0.1
76 0.1
77 0.1
78 0.13
79 0.13
80 0.13
81 0.18
82 0.19
83 0.2
84 0.2
85 0.21
86 0.2
87 0.2
88 0.22
89 0.17
90 0.17
91 0.17
92 0.16
93 0.16
94 0.2
95 0.21
96 0.22
97 0.24
98 0.24
99 0.25
100 0.26
101 0.32
102 0.32
103 0.37
104 0.36
105 0.39
106 0.38
107 0.41
108 0.44
109 0.4
110 0.43
111 0.46
112 0.53
113 0.5
114 0.54
115 0.52
116 0.49
117 0.49
118 0.47
119 0.41
120 0.38
121 0.4
122 0.37
123 0.36
124 0.4
125 0.41
126 0.38
127 0.38
128 0.36
129 0.35
130 0.35
131 0.34
132 0.35
133 0.32
134 0.3
135 0.29
136 0.26
137 0.23
138 0.2
139 0.19
140 0.13
141 0.16
142 0.15
143 0.15
144 0.19
145 0.21
146 0.25
147 0.26
148 0.24
149 0.22
150 0.27
151 0.34
152 0.34
153 0.37
154 0.34
155 0.33
156 0.33
157 0.31
158 0.27
159 0.18
160 0.16
161 0.1
162 0.1
163 0.1
164 0.09
165 0.09
166 0.08
167 0.08
168 0.05
169 0.05
170 0.04
171 0.06
172 0.08
173 0.09
174 0.11
175 0.13
176 0.15
177 0.2
178 0.23
179 0.25
180 0.27
181 0.29
182 0.31
183 0.31
184 0.29
185 0.27
186 0.3
187 0.3
188 0.28
189 0.32
190 0.34
191 0.31
192 0.32
193 0.35
194 0.36
195 0.42
196 0.5
197 0.53
198 0.58
199 0.66
200 0.73
201 0.77
202 0.79
203 0.8
204 0.81
205 0.77
206 0.73
207 0.74
208 0.69
209 0.63
210 0.62
211 0.57
212 0.48
213 0.47
214 0.43
215 0.34
216 0.31
217 0.27
218 0.19
219 0.14
220 0.14
221 0.1
222 0.09
223 0.08
224 0.07
225 0.07
226 0.07
227 0.08
228 0.07
229 0.08
230 0.09
231 0.09
232 0.1