Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139A205

Protein Details
Accession A0A139A205   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
129-152ASPDPSRQFKKRPSSKASNRDWCYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, cyto_nucl 6.5, mito 5, plas 4, nucl 2.5, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008949  Isoprenoid_synthase_dom_sf  
IPR002060  Squ/phyt_synthse  
IPR006449  Squal_synth-like  
IPR019845  Squalene/phytoene_synthase_CS  
IPR044844  Trans_IPPS_euk-type  
IPR033904  Trans_IPPS_HH  
Gene Ontology GO:0016020  C:membrane  
GO:0004310  F:farnesyl-diphosphate farnesyltransferase activity  
GO:0051996  F:squalene synthase activity  
GO:0008610  P:lipid biosynthetic process  
Pfam View protein in Pfam  
PF00494  SQS_PSY  
PROSITE View protein in PROSITE  
PS01045  SQUALEN_PHYTOEN_SYN_2  
CDD cd00683  Trans_IPPS_HH  
Amino Acid Sequences RIFGHQISVVGAEEVRESRAGCESGVRAKLRFVAPQSCTPLHQSDSPWKQNRAPCEPSSLRLLRDRKAISRQSPTRLSWDHRSTKSSSSSRLLHLAIRFTEIFSSDMASDLAASLFHPSELYAIFSFLASPDPSRQFKKRPSSKASNRDWCYYFLNLTSRSFARVIQELNDEMRHPVCIFYLVLRGLDTVEDDMTLPKARKLAVLRSFHELIYQRGWTFTENGPDEKDRELLVMFDKVIEEFLGLAEKYRAVIADITKRMAAGMADFIEGKKVVTMDDYNLYTHYVAGLVGHGLTGLFIASGLEPQLSALSRDRALFLSNQMGLMLQKINILRDFSEDVPQGRVFWPKDVWGKYVANVEDMLEPRNLELARACLNDLCGDALSLVPDSLEYLSLLRDPTIFRFCAIPQTMAISTLTLVLDNPKNFRMPLLKIRKGQACEQILGSGDFDSVRVLYLRELRAQAAKVFGIVRRGGEDVKRGTVLDLDIALGKAESAVRHHDKIRDVFTTEKGTTRPFPFTVHPEDPSREVARKRASSSGSGSWAVVGLAVVVVAVGFALWNGEQGQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.13
5 0.14
6 0.19
7 0.19
8 0.17
9 0.2
10 0.22
11 0.28
12 0.35
13 0.35
14 0.31
15 0.33
16 0.39
17 0.37
18 0.4
19 0.38
20 0.4
21 0.42
22 0.48
23 0.53
24 0.49
25 0.48
26 0.47
27 0.46
28 0.4
29 0.4
30 0.38
31 0.41
32 0.49
33 0.57
34 0.6
35 0.61
36 0.65
37 0.66
38 0.69
39 0.68
40 0.65
41 0.56
42 0.58
43 0.56
44 0.51
45 0.56
46 0.5
47 0.45
48 0.47
49 0.5
50 0.44
51 0.51
52 0.52
53 0.5
54 0.56
55 0.62
56 0.6
57 0.66
58 0.68
59 0.67
60 0.69
61 0.65
62 0.63
63 0.6
64 0.59
65 0.58
66 0.61
67 0.62
68 0.6
69 0.62
70 0.57
71 0.58
72 0.61
73 0.55
74 0.52
75 0.49
76 0.49
77 0.47
78 0.48
79 0.43
80 0.38
81 0.36
82 0.34
83 0.29
84 0.29
85 0.26
86 0.23
87 0.22
88 0.19
89 0.17
90 0.13
91 0.14
92 0.1
93 0.1
94 0.1
95 0.09
96 0.07
97 0.07
98 0.07
99 0.05
100 0.05
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.08
107 0.08
108 0.11
109 0.09
110 0.09
111 0.09
112 0.09
113 0.09
114 0.08
115 0.11
116 0.09
117 0.1
118 0.15
119 0.21
120 0.26
121 0.32
122 0.38
123 0.45
124 0.53
125 0.63
126 0.67
127 0.71
128 0.76
129 0.81
130 0.84
131 0.86
132 0.87
133 0.86
134 0.8
135 0.76
136 0.69
137 0.61
138 0.54
139 0.45
140 0.36
141 0.29
142 0.3
143 0.26
144 0.25
145 0.26
146 0.22
147 0.23
148 0.23
149 0.21
150 0.19
151 0.2
152 0.2
153 0.19
154 0.21
155 0.19
156 0.2
157 0.2
158 0.17
159 0.16
160 0.15
161 0.14
162 0.12
163 0.11
164 0.09
165 0.1
166 0.1
167 0.09
168 0.12
169 0.12
170 0.12
171 0.11
172 0.11
173 0.09
174 0.09
175 0.09
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.07
182 0.1
183 0.1
184 0.1
185 0.12
186 0.12
187 0.17
188 0.19
189 0.27
190 0.33
191 0.38
192 0.38
193 0.42
194 0.43
195 0.38
196 0.4
197 0.32
198 0.26
199 0.23
200 0.23
201 0.17
202 0.17
203 0.18
204 0.14
205 0.16
206 0.16
207 0.2
208 0.2
209 0.21
210 0.23
211 0.23
212 0.23
213 0.21
214 0.21
215 0.14
216 0.13
217 0.12
218 0.1
219 0.1
220 0.1
221 0.09
222 0.08
223 0.08
224 0.07
225 0.07
226 0.06
227 0.05
228 0.04
229 0.04
230 0.05
231 0.05
232 0.05
233 0.05
234 0.05
235 0.06
236 0.06
237 0.06
238 0.05
239 0.07
240 0.09
241 0.16
242 0.16
243 0.17
244 0.17
245 0.17
246 0.16
247 0.14
248 0.12
249 0.05
250 0.06
251 0.05
252 0.06
253 0.06
254 0.06
255 0.06
256 0.06
257 0.06
258 0.05
259 0.05
260 0.05
261 0.06
262 0.07
263 0.07
264 0.1
265 0.1
266 0.1
267 0.1
268 0.11
269 0.09
270 0.09
271 0.07
272 0.05
273 0.04
274 0.04
275 0.04
276 0.03
277 0.03
278 0.03
279 0.03
280 0.02
281 0.02
282 0.02
283 0.02
284 0.02
285 0.02
286 0.02
287 0.02
288 0.03
289 0.03
290 0.03
291 0.03
292 0.03
293 0.04
294 0.04
295 0.06
296 0.07
297 0.09
298 0.1
299 0.11
300 0.12
301 0.11
302 0.12
303 0.12
304 0.12
305 0.13
306 0.12
307 0.12
308 0.1
309 0.1
310 0.09
311 0.1
312 0.08
313 0.06
314 0.08
315 0.09
316 0.1
317 0.11
318 0.12
319 0.11
320 0.13
321 0.15
322 0.14
323 0.17
324 0.17
325 0.17
326 0.19
327 0.19
328 0.17
329 0.16
330 0.21
331 0.18
332 0.19
333 0.19
334 0.21
335 0.28
336 0.28
337 0.28
338 0.27
339 0.27
340 0.27
341 0.31
342 0.27
343 0.21
344 0.19
345 0.19
346 0.17
347 0.17
348 0.16
349 0.12
350 0.12
351 0.11
352 0.14
353 0.13
354 0.1
355 0.1
356 0.11
357 0.14
358 0.15
359 0.15
360 0.12
361 0.13
362 0.13
363 0.12
364 0.11
365 0.07
366 0.07
367 0.06
368 0.06
369 0.06
370 0.05
371 0.05
372 0.04
373 0.04
374 0.05
375 0.05
376 0.05
377 0.05
378 0.05
379 0.06
380 0.07
381 0.08
382 0.07
383 0.08
384 0.09
385 0.13
386 0.17
387 0.16
388 0.16
389 0.18
390 0.18
391 0.25
392 0.25
393 0.22
394 0.19
395 0.22
396 0.22
397 0.2
398 0.2
399 0.12
400 0.1
401 0.11
402 0.11
403 0.07
404 0.07
405 0.11
406 0.15
407 0.17
408 0.19
409 0.19
410 0.21
411 0.21
412 0.24
413 0.25
414 0.26
415 0.35
416 0.43
417 0.48
418 0.51
419 0.57
420 0.6
421 0.58
422 0.58
423 0.57
424 0.5
425 0.44
426 0.4
427 0.35
428 0.3
429 0.27
430 0.22
431 0.13
432 0.1
433 0.09
434 0.08
435 0.08
436 0.07
437 0.07
438 0.07
439 0.07
440 0.1
441 0.16
442 0.18
443 0.21
444 0.22
445 0.24
446 0.27
447 0.28
448 0.27
449 0.23
450 0.21
451 0.19
452 0.2
453 0.19
454 0.2
455 0.19
456 0.19
457 0.18
458 0.2
459 0.22
460 0.22
461 0.27
462 0.25
463 0.27
464 0.27
465 0.25
466 0.24
467 0.23
468 0.2
469 0.15
470 0.12
471 0.1
472 0.1
473 0.1
474 0.1
475 0.08
476 0.07
477 0.07
478 0.08
479 0.08
480 0.1
481 0.18
482 0.24
483 0.28
484 0.32
485 0.37
486 0.42
487 0.47
488 0.49
489 0.44
490 0.42
491 0.42
492 0.42
493 0.44
494 0.39
495 0.36
496 0.33
497 0.35
498 0.39
499 0.39
500 0.4
501 0.34
502 0.37
503 0.4
504 0.44
505 0.48
506 0.45
507 0.45
508 0.45
509 0.47
510 0.46
511 0.46
512 0.45
513 0.43
514 0.42
515 0.47
516 0.51
517 0.53
518 0.54
519 0.55
520 0.54
521 0.52
522 0.54
523 0.51
524 0.46
525 0.41
526 0.37
527 0.3
528 0.27
529 0.21
530 0.16
531 0.1
532 0.06
533 0.05
534 0.04
535 0.04
536 0.03
537 0.03
538 0.02
539 0.02
540 0.02
541 0.02
542 0.02
543 0.04
544 0.04
545 0.06