Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AU63

Protein Details
Accession A0A139AU63   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
186-214AREGERKKQEQREREKREKAKQKKITAAGBasic
NLS Segment(s)
PositionSequence
190-212ERKKQEQREREKREKAKQKKITA
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029147  CFAP77  
Pfam View protein in Pfam  
PF14825  CFAP77  
Amino Acid Sequences MPSAAPPAPSRAGSRSSVVNVLLLKSPVGAARPSTYKLPSQENPSHVYGIRVEKPVDENAATVLRHWEVNKQSKAHVHGFDYVSMNRASAKAGLTTAKDVRDFQKEHPIRLKARSSSSGGAGSACGGGAESESFYHNSPLAAQPGVQKKSRTPLPSDVHPNHTYGKPVRPSTPVAQLMIDRTTTDAREGERKKQEQREREKREKAKQKKITAAGLVAARKPAVQKSEIDPKNLWRISRFTKADHKVDDVWVEPPRTTGPDIKIPFEVPVHMPTKNAVGAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.31
4 0.32
5 0.28
6 0.27
7 0.24
8 0.23
9 0.23
10 0.19
11 0.16
12 0.14
13 0.14
14 0.13
15 0.14
16 0.13
17 0.13
18 0.17
19 0.21
20 0.23
21 0.26
22 0.28
23 0.31
24 0.34
25 0.4
26 0.4
27 0.45
28 0.49
29 0.49
30 0.51
31 0.48
32 0.46
33 0.38
34 0.36
35 0.31
36 0.31
37 0.32
38 0.3
39 0.29
40 0.28
41 0.3
42 0.3
43 0.29
44 0.22
45 0.18
46 0.17
47 0.2
48 0.18
49 0.15
50 0.16
51 0.14
52 0.16
53 0.16
54 0.21
55 0.26
56 0.36
57 0.4
58 0.39
59 0.42
60 0.45
61 0.5
62 0.49
63 0.43
64 0.36
65 0.37
66 0.36
67 0.35
68 0.33
69 0.28
70 0.24
71 0.21
72 0.18
73 0.14
74 0.13
75 0.11
76 0.1
77 0.1
78 0.09
79 0.1
80 0.12
81 0.12
82 0.16
83 0.17
84 0.17
85 0.17
86 0.19
87 0.21
88 0.26
89 0.27
90 0.26
91 0.35
92 0.35
93 0.38
94 0.43
95 0.45
96 0.42
97 0.45
98 0.48
99 0.41
100 0.43
101 0.42
102 0.38
103 0.34
104 0.32
105 0.27
106 0.22
107 0.18
108 0.14
109 0.11
110 0.08
111 0.06
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.05
120 0.06
121 0.06
122 0.07
123 0.07
124 0.07
125 0.08
126 0.09
127 0.1
128 0.09
129 0.09
130 0.14
131 0.2
132 0.23
133 0.24
134 0.24
135 0.24
136 0.31
137 0.35
138 0.33
139 0.31
140 0.37
141 0.38
142 0.43
143 0.5
144 0.46
145 0.47
146 0.45
147 0.42
148 0.36
149 0.33
150 0.32
151 0.26
152 0.31
153 0.3
154 0.31
155 0.32
156 0.33
157 0.36
158 0.35
159 0.4
160 0.35
161 0.3
162 0.29
163 0.26
164 0.25
165 0.22
166 0.19
167 0.11
168 0.11
169 0.12
170 0.11
171 0.12
172 0.12
173 0.12
174 0.22
175 0.25
176 0.32
177 0.39
178 0.45
179 0.52
180 0.6
181 0.68
182 0.68
183 0.77
184 0.79
185 0.8
186 0.84
187 0.86
188 0.85
189 0.87
190 0.88
191 0.88
192 0.87
193 0.87
194 0.85
195 0.84
196 0.79
197 0.74
198 0.65
199 0.55
200 0.47
201 0.41
202 0.35
203 0.27
204 0.23
205 0.18
206 0.17
207 0.18
208 0.19
209 0.19
210 0.19
211 0.22
212 0.27
213 0.38
214 0.39
215 0.41
216 0.38
217 0.4
218 0.48
219 0.47
220 0.43
221 0.36
222 0.4
223 0.42
224 0.51
225 0.48
226 0.43
227 0.51
228 0.57
229 0.6
230 0.57
231 0.55
232 0.47
233 0.47
234 0.44
235 0.35
236 0.32
237 0.3
238 0.28
239 0.24
240 0.23
241 0.23
242 0.24
243 0.26
244 0.28
245 0.28
246 0.36
247 0.39
248 0.4
249 0.4
250 0.38
251 0.37
252 0.32
253 0.3
254 0.23
255 0.27
256 0.27
257 0.25
258 0.25
259 0.24
260 0.27