Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139A7J6

Protein Details
Accession A0A139A7J6   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
157-188RPQPLGKVKEQRRREKVKKERREREEKKVQIKBasic
NLS Segment(s)
PositionSequence
29-49GGRGRGRGRGERGRGRGRGRG
162-184GKVKEQRRREKVKKERREREEKK
Subcellular Location(s) mito 16, nucl 7, cyto_nucl 6.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007811  RPC4  
Gene Ontology GO:0005666  C:RNA polymerase III complex  
GO:0003677  F:DNA binding  
GO:0006383  P:transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF05132  RNA_pol_Rpc4  
Amino Acid Sequences MKFMPTVRATKVAKAEPAVGPSESDGGEGGRGRGRGRGERGRGRGRGRGEFGKQELTASGPFALGPAARPNVRSGGGGFAPTLRAASGGPGSGSASGGGFSGSRVGGGGSSRASKVKSEGDGSGDEGKDAAFSDSDDDSEEADNANWGQGPSPLQMRPQPLGKVKEQRRREKVKKERREREEKKVQIKAEPMEEDGDGRGSTPQTVSSSTPTLMELDEKVPASGITGEPGSGIQSPGLELAAFERISSEKPENPPLLFFQLPKLLPRLDPNAMDITPVSSSSSTSMKTEVDIKADPSKPQPSSGAGSAKAAVPTILSQSGRIGTLRVHRSGRVTMDLGGAPFVVYPGSRVGFAEQVSLIQVMDDHKGKVKQEVPRGWEKPGEGAKRAKLEVVGEVASDGGRFVVAAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.39
4 0.4
5 0.36
6 0.29
7 0.26
8 0.23
9 0.23
10 0.18
11 0.15
12 0.13
13 0.1
14 0.13
15 0.13
16 0.14
17 0.15
18 0.17
19 0.17
20 0.22
21 0.27
22 0.33
23 0.4
24 0.48
25 0.54
26 0.62
27 0.7
28 0.74
29 0.76
30 0.73
31 0.71
32 0.68
33 0.66
34 0.63
35 0.62
36 0.58
37 0.57
38 0.54
39 0.53
40 0.46
41 0.39
42 0.34
43 0.29
44 0.24
45 0.19
46 0.17
47 0.11
48 0.11
49 0.1
50 0.11
51 0.08
52 0.09
53 0.13
54 0.17
55 0.17
56 0.19
57 0.21
58 0.23
59 0.24
60 0.24
61 0.19
62 0.2
63 0.2
64 0.19
65 0.17
66 0.14
67 0.14
68 0.13
69 0.12
70 0.07
71 0.08
72 0.07
73 0.09
74 0.09
75 0.09
76 0.08
77 0.09
78 0.09
79 0.09
80 0.09
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.07
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.07
95 0.08
96 0.08
97 0.1
98 0.11
99 0.13
100 0.14
101 0.15
102 0.18
103 0.21
104 0.22
105 0.23
106 0.23
107 0.24
108 0.23
109 0.25
110 0.25
111 0.2
112 0.18
113 0.15
114 0.14
115 0.11
116 0.11
117 0.09
118 0.05
119 0.05
120 0.08
121 0.08
122 0.09
123 0.09
124 0.09
125 0.09
126 0.1
127 0.1
128 0.07
129 0.07
130 0.08
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.07
137 0.09
138 0.1
139 0.13
140 0.14
141 0.16
142 0.2
143 0.23
144 0.23
145 0.25
146 0.29
147 0.32
148 0.35
149 0.39
150 0.45
151 0.51
152 0.58
153 0.64
154 0.69
155 0.72
156 0.79
157 0.82
158 0.83
159 0.85
160 0.87
161 0.89
162 0.9
163 0.9
164 0.88
165 0.91
166 0.86
167 0.85
168 0.84
169 0.81
170 0.78
171 0.74
172 0.66
173 0.58
174 0.55
175 0.46
176 0.39
177 0.32
178 0.25
179 0.2
180 0.19
181 0.15
182 0.12
183 0.1
184 0.07
185 0.07
186 0.07
187 0.06
188 0.06
189 0.06
190 0.07
191 0.07
192 0.09
193 0.1
194 0.11
195 0.12
196 0.12
197 0.12
198 0.12
199 0.11
200 0.1
201 0.09
202 0.08
203 0.08
204 0.09
205 0.09
206 0.08
207 0.08
208 0.07
209 0.07
210 0.07
211 0.06
212 0.06
213 0.06
214 0.06
215 0.06
216 0.06
217 0.06
218 0.06
219 0.06
220 0.05
221 0.05
222 0.05
223 0.05
224 0.06
225 0.04
226 0.04
227 0.05
228 0.07
229 0.07
230 0.07
231 0.07
232 0.08
233 0.09
234 0.13
235 0.15
236 0.17
237 0.2
238 0.26
239 0.27
240 0.27
241 0.27
242 0.26
243 0.27
244 0.24
245 0.21
246 0.18
247 0.22
248 0.22
249 0.22
250 0.23
251 0.19
252 0.19
253 0.23
254 0.26
255 0.23
256 0.23
257 0.24
258 0.24
259 0.23
260 0.22
261 0.18
262 0.14
263 0.12
264 0.12
265 0.11
266 0.08
267 0.08
268 0.1
269 0.12
270 0.12
271 0.12
272 0.13
273 0.12
274 0.13
275 0.18
276 0.17
277 0.19
278 0.19
279 0.21
280 0.26
281 0.28
282 0.29
283 0.3
284 0.36
285 0.33
286 0.34
287 0.34
288 0.3
289 0.31
290 0.34
291 0.32
292 0.25
293 0.26
294 0.24
295 0.23
296 0.2
297 0.17
298 0.12
299 0.09
300 0.09
301 0.11
302 0.13
303 0.12
304 0.12
305 0.14
306 0.15
307 0.15
308 0.15
309 0.13
310 0.13
311 0.22
312 0.26
313 0.29
314 0.3
315 0.32
316 0.35
317 0.38
318 0.38
319 0.33
320 0.3
321 0.26
322 0.27
323 0.25
324 0.22
325 0.18
326 0.15
327 0.11
328 0.09
329 0.08
330 0.06
331 0.05
332 0.06
333 0.09
334 0.1
335 0.1
336 0.11
337 0.13
338 0.16
339 0.16
340 0.17
341 0.13
342 0.13
343 0.14
344 0.13
345 0.11
346 0.08
347 0.09
348 0.09
349 0.13
350 0.15
351 0.15
352 0.21
353 0.25
354 0.26
355 0.33
356 0.38
357 0.42
358 0.5
359 0.56
360 0.56
361 0.63
362 0.64
363 0.6
364 0.58
365 0.51
366 0.49
367 0.51
368 0.51
369 0.46
370 0.5
371 0.53
372 0.54
373 0.54
374 0.47
375 0.41
376 0.36
377 0.34
378 0.3
379 0.24
380 0.18
381 0.18
382 0.16
383 0.14
384 0.12
385 0.09
386 0.05
387 0.05
388 0.04