Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0WAC2

Protein Details
Accession G0WAC2   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-51MVQKALKVTKKSKDPRRITKKQKNLRKAAPLQLKSKKKSLQHLKKLNKSASHydrophilic
68-87ELLKGTRKEIERKNRKENSKBasic
NLS Segment(s)
PositionSequence
7-45KVTKKSKDPRRITKKQKNLRKAAPLQLKSKKKSLQHLKK
74-87RKEIERKNRKENSK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG ndi:NDAI_0D04190  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MVQKALKVTKKSKDPRRITKKQKNLRKAAPLQLKSKKKSLQHLKKLNKSASLTETTEKLIASRVGHLELLKGTRKEIERKNRKENSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.89
4 0.91
5 0.91
6 0.92
7 0.92
8 0.92
9 0.92
10 0.91
11 0.89
12 0.86
13 0.84
14 0.79
15 0.78
16 0.77
17 0.71
18 0.7
19 0.7
20 0.7
21 0.64
22 0.65
23 0.61
24 0.56
25 0.62
26 0.65
27 0.66
28 0.68
29 0.76
30 0.77
31 0.79
32 0.81
33 0.72
34 0.66
35 0.57
36 0.49
37 0.42
38 0.37
39 0.31
40 0.26
41 0.25
42 0.21
43 0.2
44 0.17
45 0.13
46 0.12
47 0.12
48 0.12
49 0.14
50 0.14
51 0.15
52 0.16
53 0.16
54 0.15
55 0.15
56 0.18
57 0.21
58 0.2
59 0.2
60 0.25
61 0.3
62 0.38
63 0.46
64 0.53
65 0.59
66 0.67
67 0.77