Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AQU1

Protein Details
Accession A0A139AQU1    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
89-114PADDKKGGKKEEKKKEEKKEEEEDDDAcidic
NLS Segment(s)
PositionSequence
93-107KKGGKKEEKKKEEKK
Subcellular Location(s) cyto 15, cyto_nucl 10, pero 4, nucl 3, cysk 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038716  P1/P2_N_sf  
IPR027534  Ribosomal_L12/P1/P2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006414  P:translational elongation  
Pfam View protein in Pfam  
PF00428  Ribosomal_60s  
CDD cd05831  Ribosomal_P1  
Amino Acid Sequences MAAEFGPNEQACAYAALILVDEGLPVTADKIIKLVEAAGIEMEGIWAKLFAKALEGRDLAAHFTNFSEAPTASVSVAAPVAAAPAADAPADDKKGGKKEEKKKEEKKEEEEDDDMGFGLFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.07
6 0.07
7 0.05
8 0.05
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.06
15 0.07
16 0.07
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.07
23 0.07
24 0.07
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.05
36 0.05
37 0.05
38 0.08
39 0.1
40 0.12
41 0.14
42 0.14
43 0.13
44 0.14
45 0.14
46 0.12
47 0.11
48 0.1
49 0.07
50 0.07
51 0.08
52 0.07
53 0.07
54 0.07
55 0.07
56 0.08
57 0.08
58 0.09
59 0.07
60 0.08
61 0.08
62 0.06
63 0.07
64 0.05
65 0.04
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.03
72 0.04
73 0.03
74 0.04
75 0.06
76 0.09
77 0.1
78 0.11
79 0.12
80 0.17
81 0.24
82 0.3
83 0.37
84 0.45
85 0.54
86 0.65
87 0.74
88 0.79
89 0.83
90 0.89
91 0.91
92 0.89
93 0.86
94 0.85
95 0.8
96 0.75
97 0.67
98 0.57
99 0.46
100 0.38
101 0.3