Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AL66

Protein Details
Accession A0A139AL66    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-73DDALEPKSSKRKPPRRNNVKBasic
NLS Segment(s)
PositionSequence
60-73KSSKRKPPRRNNVK
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MDIRRFFGPSGATGKGKKNEGRVNDEDDVKVLPEKSTQSPAKSDQRFKRDAEHDDALEPKSSKRKPPRRNNVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.41
4 0.42
5 0.46
6 0.48
7 0.5
8 0.55
9 0.51
10 0.52
11 0.49
12 0.46
13 0.38
14 0.32
15 0.27
16 0.19
17 0.17
18 0.11
19 0.09
20 0.09
21 0.12
22 0.13
23 0.2
24 0.21
25 0.21
26 0.24
27 0.29
28 0.37
29 0.4
30 0.48
31 0.48
32 0.53
33 0.55
34 0.54
35 0.57
36 0.53
37 0.53
38 0.51
39 0.46
40 0.4
41 0.39
42 0.4
43 0.32
44 0.3
45 0.26
46 0.23
47 0.29
48 0.33
49 0.42
50 0.51
51 0.61
52 0.68
53 0.79