Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AJ46

Protein Details
Accession A0A139AJ46   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
158-185PSAASKPGSRRPRRMACRWWRREWPGPEHydrophilic
NLS Segment(s)
PositionSequence
130-130R
132-136GGRVR
148-171KHVAKPANNAPSAASKPGSRRPRR
Subcellular Location(s) mito 19, cyto 5, nucl 2
Family & Domain DBs
Amino Acid Sequences MELRRAGMPRDPRGLSNPRRPTLLSHLASLLPPVLTHADVQGVPAPSKAVVQPGKVYITQRGYKAEWEGDVGVGPRDQAAVTRHEPFHRRRRLLAAIVLIKDEASARREANASCASGRVPTAGAMGLRRRLGGRVRMGRSVSATPASKHVAKPANNAPSAASKPGSRRPRRMACRWWRREWPGPEVLVWEGWALGNIAAVGSRVGMDLDDGTGRTGKQEKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.59
3 0.61
4 0.65
5 0.59
6 0.61
7 0.59
8 0.57
9 0.56
10 0.57
11 0.48
12 0.4
13 0.39
14 0.37
15 0.36
16 0.31
17 0.22
18 0.12
19 0.1
20 0.1
21 0.1
22 0.1
23 0.11
24 0.1
25 0.12
26 0.12
27 0.13
28 0.15
29 0.15
30 0.15
31 0.15
32 0.15
33 0.13
34 0.14
35 0.13
36 0.17
37 0.18
38 0.19
39 0.21
40 0.23
41 0.25
42 0.26
43 0.27
44 0.25
45 0.29
46 0.31
47 0.31
48 0.32
49 0.31
50 0.31
51 0.32
52 0.27
53 0.21
54 0.19
55 0.17
56 0.14
57 0.13
58 0.11
59 0.09
60 0.08
61 0.08
62 0.06
63 0.06
64 0.06
65 0.08
66 0.09
67 0.13
68 0.16
69 0.2
70 0.22
71 0.25
72 0.31
73 0.36
74 0.45
75 0.49
76 0.49
77 0.48
78 0.53
79 0.54
80 0.51
81 0.45
82 0.4
83 0.33
84 0.3
85 0.28
86 0.22
87 0.17
88 0.14
89 0.12
90 0.08
91 0.08
92 0.09
93 0.09
94 0.1
95 0.12
96 0.12
97 0.15
98 0.15
99 0.14
100 0.13
101 0.13
102 0.12
103 0.11
104 0.11
105 0.08
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.08
112 0.1
113 0.12
114 0.12
115 0.12
116 0.12
117 0.15
118 0.19
119 0.23
120 0.3
121 0.35
122 0.38
123 0.41
124 0.41
125 0.39
126 0.37
127 0.32
128 0.26
129 0.21
130 0.2
131 0.17
132 0.2
133 0.22
134 0.22
135 0.21
136 0.27
137 0.3
138 0.31
139 0.36
140 0.41
141 0.44
142 0.42
143 0.42
144 0.36
145 0.34
146 0.34
147 0.3
148 0.24
149 0.2
150 0.25
151 0.34
152 0.43
153 0.46
154 0.53
155 0.61
156 0.7
157 0.76
158 0.8
159 0.82
160 0.82
161 0.86
162 0.85
163 0.83
164 0.82
165 0.81
166 0.82
167 0.76
168 0.72
169 0.66
170 0.59
171 0.52
172 0.45
173 0.38
174 0.28
175 0.23
176 0.16
177 0.1
178 0.09
179 0.09
180 0.07
181 0.06
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.04
189 0.05
190 0.05
191 0.05
192 0.05
193 0.06
194 0.06
195 0.07
196 0.08
197 0.08
198 0.1
199 0.11
200 0.11
201 0.15