Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AXS2

Protein Details
Accession A0A139AXS2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
38-59WSYSCSRSRSRSRSRSRSRLLPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MVLPFPAVRFPLPPNETDAEAGTGTGTSPRASSSSSSWSYSCSRSRSRSRSRSRSRLLPLRALPLAPVGVSSTAYILLAFPCPCVGVGVCRGVGVSSGPSHLLSRSQSPRSRSGDPPPPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.32
4 0.3
5 0.29
6 0.21
7 0.18
8 0.17
9 0.12
10 0.1
11 0.08
12 0.09
13 0.08
14 0.07
15 0.07
16 0.08
17 0.09
18 0.1
19 0.12
20 0.14
21 0.2
22 0.22
23 0.23
24 0.22
25 0.25
26 0.26
27 0.29
28 0.31
29 0.29
30 0.33
31 0.39
32 0.48
33 0.55
34 0.62
35 0.68
36 0.74
37 0.8
38 0.83
39 0.85
40 0.81
41 0.79
42 0.76
43 0.74
44 0.66
45 0.61
46 0.53
47 0.47
48 0.42
49 0.34
50 0.27
51 0.19
52 0.16
53 0.09
54 0.08
55 0.05
56 0.05
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.08
72 0.08
73 0.08
74 0.11
75 0.12
76 0.12
77 0.12
78 0.12
79 0.11
80 0.11
81 0.09
82 0.09
83 0.08
84 0.09
85 0.1
86 0.11
87 0.12
88 0.12
89 0.15
90 0.16
91 0.24
92 0.31
93 0.38
94 0.43
95 0.47
96 0.55
97 0.58
98 0.61
99 0.58
100 0.6