Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AHN0

Protein Details
Accession A0A139AHN0   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-78TNGPSLKKCSRCRRARYCSTACHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 6, pero 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS50865  ZF_MYND_2  
Amino Acid Sequences MASKPEAEPSIVDFINVLRIPSSHYGIKKPFRNFLLGAVCCWFQCQNPVTMPGPDFTNGPSLKKCSRCRRARYCSTACQKADWKWDKIVCGKTELRVWRIWARSRGGCWRHAYPGRLTRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.21
3 0.2
4 0.17
5 0.12
6 0.13
7 0.17
8 0.2
9 0.24
10 0.22
11 0.24
12 0.3
13 0.38
14 0.46
15 0.5
16 0.5
17 0.53
18 0.5
19 0.52
20 0.46
21 0.44
22 0.44
23 0.37
24 0.34
25 0.29
26 0.27
27 0.22
28 0.23
29 0.18
30 0.1
31 0.15
32 0.15
33 0.16
34 0.17
35 0.21
36 0.21
37 0.21
38 0.21
39 0.16
40 0.16
41 0.14
42 0.13
43 0.1
44 0.15
45 0.14
46 0.15
47 0.15
48 0.19
49 0.23
50 0.31
51 0.4
52 0.44
53 0.54
54 0.62
55 0.71
56 0.77
57 0.82
58 0.82
59 0.83
60 0.78
61 0.77
62 0.75
63 0.73
64 0.63
65 0.58
66 0.54
67 0.49
68 0.54
69 0.5
70 0.45
71 0.43
72 0.45
73 0.45
74 0.47
75 0.48
76 0.39
77 0.39
78 0.38
79 0.35
80 0.4
81 0.4
82 0.37
83 0.33
84 0.37
85 0.38
86 0.43
87 0.47
88 0.46
89 0.48
90 0.49
91 0.52
92 0.57
93 0.54
94 0.54
95 0.53
96 0.51
97 0.54
98 0.56
99 0.55
100 0.54
101 0.59