Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139ATB8

Protein Details
Accession A0A139ATB8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-25PSDFLARRRLHRLRRAQPQLSYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MPKPSDFLARRRLHRLRRAQPQLSYCHQPLALAMGSLLLFGWSTAVPQILVFDPVLDRNEVRLRHLGGRGLSAGAGIRGHPLRDMVADGFAADLEGGVLGEREHLRRVSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.78
4 0.82
5 0.86
6 0.82
7 0.79
8 0.74
9 0.7
10 0.64
11 0.61
12 0.5
13 0.43
14 0.37
15 0.31
16 0.26
17 0.23
18 0.18
19 0.11
20 0.1
21 0.08
22 0.08
23 0.08
24 0.07
25 0.04
26 0.03
27 0.03
28 0.04
29 0.03
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.06
36 0.05
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.08
43 0.07
44 0.07
45 0.09
46 0.14
47 0.14
48 0.16
49 0.18
50 0.19
51 0.22
52 0.24
53 0.24
54 0.19
55 0.2
56 0.18
57 0.16
58 0.13
59 0.1
60 0.08
61 0.06
62 0.06
63 0.05
64 0.08
65 0.09
66 0.1
67 0.1
68 0.11
69 0.11
70 0.11
71 0.13
72 0.1
73 0.1
74 0.1
75 0.09
76 0.08
77 0.08
78 0.07
79 0.05
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.08
88 0.1
89 0.12
90 0.16