Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AEZ0

Protein Details
Accession A0A139AEZ0    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-118QDPEANRKSHSRKSKGKEKPPRKHTLPPLACBasic
NLS Segment(s)
PositionSequence
94-111RKSHSRKSKGKEKPPRKH
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
Pfam View protein in Pfam  
PF00385  Chromo  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
CDD cd00024  CD_CSD  
Amino Acid Sequences MKSCYLIMWKGYPREFDTWEVAANLQADHKLINKFEAVWTSLKVHPPYGVLEEKVRLEDGDVSDDEVTVLSSDDSGDDMSVGSDRTAQDPEANRKSHSRKSKGKEKPPRKHTLPPLAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.39
4 0.38
5 0.32
6 0.3
7 0.27
8 0.23
9 0.2
10 0.17
11 0.14
12 0.1
13 0.1
14 0.09
15 0.09
16 0.13
17 0.14
18 0.14
19 0.15
20 0.15
21 0.15
22 0.16
23 0.17
24 0.15
25 0.14
26 0.15
27 0.17
28 0.19
29 0.23
30 0.23
31 0.22
32 0.2
33 0.2
34 0.2
35 0.2
36 0.19
37 0.15
38 0.15
39 0.16
40 0.16
41 0.15
42 0.14
43 0.09
44 0.08
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.08
53 0.06
54 0.06
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.04
70 0.07
71 0.07
72 0.09
73 0.11
74 0.11
75 0.16
76 0.22
77 0.31
78 0.36
79 0.37
80 0.37
81 0.45
82 0.52
83 0.56
84 0.61
85 0.61
86 0.65
87 0.72
88 0.81
89 0.83
90 0.87
91 0.89
92 0.89
93 0.91
94 0.9
95 0.92
96 0.88
97 0.88
98 0.87