Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AV00

Protein Details
Accession A0A139AV00    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
2-23TSELRKRPTKGSKDTSDPQKDEHydrophilic
NLS Segment(s)
PositionSequence
143-159PAPKKKKAPPAPRPVPP
Subcellular Location(s) cyto 8plas 8, nucl 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
Amino Acid Sequences MTSELRKRPTKGSKDTSDPQKDEQSDSSEKTDAIPKVGERLPQANPDYPVHRNIPPKGAGRFRRRVLDAVAKIPEPWKTILGVIYWTLFTAILIVLLYWFILGEITFELKGIGLAKGYVGRDGKVTQYATTTATPRAAPASTPAPKKKKAPPAPRPVPPPRAFTEAELAQFDGSDPEKPVYLAFLGKVYDVSANKEAYGTGQGYNMFAGRDAARAFVTGCFNEEDGHLTHDLRGLTEDEKSGLKEWGEFYEKEGKPGGKYPYVGTVIHDPIPSDKPIPKSCRQPKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.81
4 0.8
5 0.74
6 0.69
7 0.68
8 0.63
9 0.59
10 0.53
11 0.49
12 0.44
13 0.43
14 0.42
15 0.34
16 0.32
17 0.3
18 0.34
19 0.28
20 0.26
21 0.25
22 0.22
23 0.27
24 0.3
25 0.31
26 0.27
27 0.31
28 0.31
29 0.36
30 0.39
31 0.37
32 0.38
33 0.38
34 0.4
35 0.38
36 0.39
37 0.36
38 0.38
39 0.41
40 0.41
41 0.43
42 0.44
43 0.47
44 0.49
45 0.54
46 0.57
47 0.6
48 0.65
49 0.63
50 0.65
51 0.62
52 0.58
53 0.55
54 0.55
55 0.48
56 0.45
57 0.43
58 0.36
59 0.34
60 0.33
61 0.29
62 0.22
63 0.2
64 0.17
65 0.15
66 0.16
67 0.17
68 0.15
69 0.14
70 0.12
71 0.11
72 0.1
73 0.09
74 0.08
75 0.07
76 0.06
77 0.05
78 0.05
79 0.04
80 0.04
81 0.04
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.02
88 0.02
89 0.02
90 0.03
91 0.04
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.06
100 0.05
101 0.05
102 0.05
103 0.08
104 0.08
105 0.11
106 0.1
107 0.11
108 0.12
109 0.13
110 0.14
111 0.15
112 0.15
113 0.12
114 0.13
115 0.13
116 0.14
117 0.15
118 0.15
119 0.13
120 0.13
121 0.13
122 0.12
123 0.13
124 0.11
125 0.09
126 0.1
127 0.16
128 0.19
129 0.25
130 0.32
131 0.36
132 0.39
133 0.45
134 0.51
135 0.55
136 0.61
137 0.67
138 0.69
139 0.75
140 0.78
141 0.78
142 0.78
143 0.74
144 0.73
145 0.65
146 0.59
147 0.51
148 0.5
149 0.45
150 0.38
151 0.36
152 0.27
153 0.25
154 0.21
155 0.18
156 0.13
157 0.12
158 0.11
159 0.08
160 0.07
161 0.08
162 0.08
163 0.09
164 0.09
165 0.09
166 0.09
167 0.08
168 0.09
169 0.08
170 0.07
171 0.08
172 0.08
173 0.08
174 0.08
175 0.08
176 0.11
177 0.11
178 0.15
179 0.16
180 0.16
181 0.16
182 0.16
183 0.16
184 0.13
185 0.15
186 0.12
187 0.1
188 0.11
189 0.11
190 0.12
191 0.12
192 0.11
193 0.09
194 0.08
195 0.09
196 0.08
197 0.1
198 0.1
199 0.11
200 0.1
201 0.11
202 0.11
203 0.12
204 0.14
205 0.12
206 0.14
207 0.14
208 0.14
209 0.14
210 0.14
211 0.14
212 0.12
213 0.14
214 0.14
215 0.13
216 0.13
217 0.16
218 0.16
219 0.13
220 0.14
221 0.14
222 0.13
223 0.14
224 0.15
225 0.13
226 0.14
227 0.15
228 0.15
229 0.16
230 0.15
231 0.16
232 0.17
233 0.21
234 0.24
235 0.23
236 0.25
237 0.34
238 0.33
239 0.34
240 0.37
241 0.33
242 0.32
243 0.38
244 0.41
245 0.35
246 0.36
247 0.36
248 0.38
249 0.39
250 0.37
251 0.33
252 0.34
253 0.32
254 0.33
255 0.32
256 0.25
257 0.26
258 0.3
259 0.29
260 0.27
261 0.29
262 0.34
263 0.43
264 0.5
265 0.53
266 0.61