Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139A0C4

Protein Details
Accession A0A139A0C4    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
151-181GPDCRWCIPERARKIKWRHRKWDWEMREIMRHydrophilic
NLS Segment(s)
PositionSequence
163-171RKIKWRHRK
Subcellular Location(s) nucl 18, cyto 7
Family & Domain DBs
Amino Acid Sequences IEPAASTDSINSSSMDEWEDIADDFDVLSLDSAISGALSVAGPTDAPSAPLAADDTRHPAVETEIPVDGSVNPPHSRSSTPSHSATGSADQRPANTDSHPHPHLHPATDPTHHDWTDGDPTQRPGARAFGRLRFGVRSNKTRTGEGKPNCGPDCRWCIPERARKIKWRHRKWDWEMREIMRER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.13
4 0.12
5 0.12
6 0.12
7 0.1
8 0.1
9 0.1
10 0.07
11 0.07
12 0.06
13 0.06
14 0.05
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.04
28 0.04
29 0.04
30 0.05
31 0.07
32 0.06
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.09
39 0.07
40 0.08
41 0.08
42 0.13
43 0.14
44 0.14
45 0.14
46 0.13
47 0.15
48 0.17
49 0.17
50 0.13
51 0.13
52 0.13
53 0.12
54 0.12
55 0.1
56 0.1
57 0.1
58 0.12
59 0.12
60 0.13
61 0.15
62 0.16
63 0.17
64 0.19
65 0.24
66 0.26
67 0.3
68 0.3
69 0.3
70 0.29
71 0.28
72 0.25
73 0.24
74 0.21
75 0.17
76 0.19
77 0.18
78 0.17
79 0.19
80 0.2
81 0.16
82 0.14
83 0.16
84 0.16
85 0.22
86 0.23
87 0.22
88 0.21
89 0.27
90 0.28
91 0.26
92 0.24
93 0.23
94 0.24
95 0.25
96 0.27
97 0.25
98 0.29
99 0.27
100 0.26
101 0.22
102 0.22
103 0.26
104 0.26
105 0.22
106 0.19
107 0.22
108 0.26
109 0.27
110 0.25
111 0.2
112 0.25
113 0.25
114 0.3
115 0.32
116 0.33
117 0.35
118 0.35
119 0.35
120 0.31
121 0.34
122 0.37
123 0.39
124 0.42
125 0.46
126 0.54
127 0.55
128 0.56
129 0.56
130 0.55
131 0.58
132 0.54
133 0.56
134 0.51
135 0.56
136 0.53
137 0.51
138 0.45
139 0.43
140 0.48
141 0.43
142 0.43
143 0.37
144 0.44
145 0.51
146 0.59
147 0.62
148 0.63
149 0.67
150 0.72
151 0.81
152 0.84
153 0.85
154 0.86
155 0.87
156 0.87
157 0.91
158 0.91
159 0.91
160 0.87
161 0.84
162 0.81
163 0.74