Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AWQ8

Protein Details
Accession A0A139AWQ8   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MPPKKDDKSSKTQKKPTSSGGGGKAKKKKWSKGKVKDKANNAVTHydrophilic
118-143VEEKAAKTKAPKAPKKKKAAEEEEEAHydrophilic
NLS Segment(s)
PositionSequence
5-38KDDKSSKTQKKPTSSGGGGKAKKKKWSKGKVKDK
121-136KAAKTKAPKAPKKKKA
Subcellular Location(s) nucl 20.5, cyto_nucl 13.833, mito_nucl 11.166, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKKDDKSSKTQKKPTSSGGGGKAKKKKWSKGKVKDKANNAVTIDKALYDKLVKEVPTYKLITPSVLVDRMRVNGSIARKVIKDLELKGLIKVVSTHNSQLIYTRATKEEAVEEKPVEEKAAKTKAPKAPKKKKAAEEEEEAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.78
4 0.76
5 0.7
6 0.65
7 0.65
8 0.65
9 0.62
10 0.64
11 0.66
12 0.62
13 0.67
14 0.69
15 0.71
16 0.72
17 0.78
18 0.81
19 0.83
20 0.9
21 0.89
22 0.91
23 0.89
24 0.85
25 0.84
26 0.75
27 0.68
28 0.59
29 0.51
30 0.41
31 0.34
32 0.27
33 0.18
34 0.15
35 0.11
36 0.11
37 0.09
38 0.09
39 0.1
40 0.13
41 0.12
42 0.14
43 0.18
44 0.2
45 0.23
46 0.25
47 0.23
48 0.24
49 0.24
50 0.23
51 0.19
52 0.18
53 0.15
54 0.16
55 0.16
56 0.13
57 0.13
58 0.14
59 0.14
60 0.13
61 0.12
62 0.12
63 0.14
64 0.16
65 0.16
66 0.16
67 0.15
68 0.16
69 0.17
70 0.18
71 0.19
72 0.17
73 0.22
74 0.23
75 0.24
76 0.23
77 0.23
78 0.19
79 0.16
80 0.16
81 0.14
82 0.14
83 0.15
84 0.16
85 0.17
86 0.17
87 0.17
88 0.18
89 0.17
90 0.17
91 0.18
92 0.19
93 0.18
94 0.2
95 0.2
96 0.19
97 0.23
98 0.24
99 0.24
100 0.24
101 0.23
102 0.22
103 0.24
104 0.23
105 0.19
106 0.17
107 0.16
108 0.21
109 0.28
110 0.3
111 0.33
112 0.41
113 0.48
114 0.57
115 0.65
116 0.69
117 0.73
118 0.8
119 0.87
120 0.88
121 0.89
122 0.89
123 0.88
124 0.83
125 0.79