Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AES5

Protein Details
Accession A0A139AES5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKPKPKRPVKPPSSVPLRTHydrophilic
NLS Segment(s)
PositionSequence
4-10PKPKRPV
Subcellular Location(s) plas 11, mito 7, E.R. 4, cyto 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039210  OGFOD3  
IPR044862  Pro_4_hyd_alph_FE2OG_OXY  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF13640  2OG-FeII_Oxy_3  
Amino Acid Sequences MPKPKPKRPVKPPSSVPLRTTSIPRPFALGAVLCLCLAIVAWYLTSPTRPSSADSPRHETRKAAPVYVRTNETIDKTWDVECKGGSWVGDEVVPGCTPPPCRRHATYLPSTSLTPLRSLIPASFPSRPSPRHPHIDKLQYGSFTYTALIYLSSLHTNFTGGRFFFHDSTVVEPSFGLLSSFTSGAENVHWVEKVETGERWAFTCAFTCGKGKGKGSRVNLEDVRRWWSDEFED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.78
3 0.7
4 0.65
5 0.61
6 0.54
7 0.52
8 0.51
9 0.5
10 0.49
11 0.46
12 0.44
13 0.4
14 0.38
15 0.34
16 0.26
17 0.19
18 0.17
19 0.17
20 0.12
21 0.12
22 0.11
23 0.08
24 0.07
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.07
31 0.07
32 0.09
33 0.1
34 0.11
35 0.13
36 0.14
37 0.18
38 0.24
39 0.33
40 0.41
41 0.44
42 0.5
43 0.55
44 0.58
45 0.56
46 0.51
47 0.47
48 0.48
49 0.44
50 0.4
51 0.37
52 0.39
53 0.43
54 0.44
55 0.41
56 0.32
57 0.33
58 0.31
59 0.3
60 0.26
61 0.22
62 0.21
63 0.2
64 0.2
65 0.21
66 0.2
67 0.18
68 0.16
69 0.15
70 0.14
71 0.13
72 0.11
73 0.1
74 0.09
75 0.09
76 0.09
77 0.07
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.07
84 0.11
85 0.17
86 0.2
87 0.24
88 0.29
89 0.32
90 0.39
91 0.44
92 0.48
93 0.49
94 0.48
95 0.46
96 0.42
97 0.39
98 0.33
99 0.29
100 0.22
101 0.16
102 0.13
103 0.12
104 0.11
105 0.12
106 0.11
107 0.11
108 0.12
109 0.15
110 0.16
111 0.17
112 0.21
113 0.25
114 0.27
115 0.32
116 0.38
117 0.4
118 0.48
119 0.49
120 0.52
121 0.54
122 0.59
123 0.54
124 0.5
125 0.46
126 0.38
127 0.36
128 0.3
129 0.23
130 0.16
131 0.14
132 0.09
133 0.08
134 0.07
135 0.06
136 0.05
137 0.05
138 0.06
139 0.08
140 0.08
141 0.08
142 0.08
143 0.09
144 0.1
145 0.1
146 0.12
147 0.11
148 0.12
149 0.14
150 0.17
151 0.17
152 0.17
153 0.17
154 0.15
155 0.18
156 0.2
157 0.17
158 0.14
159 0.13
160 0.13
161 0.12
162 0.11
163 0.08
164 0.05
165 0.06
166 0.08
167 0.08
168 0.08
169 0.08
170 0.08
171 0.08
172 0.09
173 0.1
174 0.09
175 0.11
176 0.11
177 0.11
178 0.12
179 0.14
180 0.16
181 0.16
182 0.16
183 0.18
184 0.21
185 0.2
186 0.21
187 0.21
188 0.19
189 0.17
190 0.19
191 0.18
192 0.17
193 0.19
194 0.2
195 0.23
196 0.3
197 0.35
198 0.38
199 0.44
200 0.51
201 0.57
202 0.61
203 0.65
204 0.6
205 0.63
206 0.63
207 0.6
208 0.57
209 0.52
210 0.51
211 0.43
212 0.44
213 0.37