Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139B0Q1

Protein Details
Accession A0A139B0Q1    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-39VSPLVWWRLCRRKPPKPCHQTTNYEAREHydrophilic
495-515MATFVRSRRRAAKRRAHAMSGHydrophilic
NLS Segment(s)
PositionSequence
275-339PATPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPATPPPPPPPTPPP
503-511RRRAAKRRA
Subcellular Location(s) extr 19, mito 4, nucl 1, cyto 1, cyto_nucl 1, E.R. 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MILVVRSCSAIVSPLVWWRLCRRKPPKPCHQTTNYEARECLESISEAHCSVGLVSQGGALSRRRGSRMKLTEGVASKRMACIRQQPLRSFLASLKVAHIGSTSPPYTATLTYKPSQQSSDVALTSDDFLPTNVASECHPSQISTVSFHLADDVCRPHFADFEDTARLAAMGWVRNSAEVGWDVYAREGCDGASFMKGGKYSYGVCAEETGLQGFGKQYVTHKVTDNFLLNLSHGTIRGVADVIQRFIRVHASPSINIASPTLKKRQAPSGDPSPPATPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPATPPPPPPPTPPPVPXPPPPATPPPATPPPAAPPAAVPPPAVPPPAVPPPAGQPPPAAPPPAAPNPAPPSGAPPAPAASEAGAATSAAGATTQTVAPSPSSGGATRAAAALSSPASTTDASGVAGTDSNGGSNSSAGSGSGSPSAMRNVPAIVGGITGALAAAVILGVLMATFVRSRRRAAKRRAHAMSGTPRPMSQIDPTRWPATPRTPMSTSSPMTPGGGDGNLSSPGGWTTASSSLGSNDSGFLMTPPSARAGPGVGFGDFGTGRNFGTQSQLATSPTGIGMRQSYSGGSLSRSAAGVFSDASISKMLRVPSPEPGEEPPEEVHETYVAKKAYRAQLPDELTVEVGDQVFVDVVSALNSFRHFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.23
4 0.26
5 0.33
6 0.43
7 0.49
8 0.58
9 0.63
10 0.69
11 0.79
12 0.87
13 0.89
14 0.89
15 0.91
16 0.9
17 0.88
18 0.85
19 0.82
20 0.82
21 0.77
22 0.68
23 0.6
24 0.52
25 0.47
26 0.39
27 0.32
28 0.23
29 0.18
30 0.17
31 0.19
32 0.19
33 0.15
34 0.15
35 0.14
36 0.12
37 0.12
38 0.12
39 0.11
40 0.09
41 0.09
42 0.1
43 0.1
44 0.11
45 0.13
46 0.13
47 0.18
48 0.22
49 0.26
50 0.3
51 0.36
52 0.41
53 0.49
54 0.55
55 0.58
56 0.57
57 0.56
58 0.57
59 0.57
60 0.55
61 0.48
62 0.41
63 0.34
64 0.34
65 0.36
66 0.31
67 0.31
68 0.36
69 0.43
70 0.49
71 0.56
72 0.55
73 0.56
74 0.57
75 0.53
76 0.45
77 0.38
78 0.37
79 0.32
80 0.29
81 0.26
82 0.26
83 0.25
84 0.23
85 0.21
86 0.15
87 0.15
88 0.2
89 0.18
90 0.15
91 0.16
92 0.18
93 0.19
94 0.21
95 0.23
96 0.22
97 0.27
98 0.28
99 0.33
100 0.35
101 0.35
102 0.35
103 0.33
104 0.31
105 0.3
106 0.33
107 0.27
108 0.25
109 0.22
110 0.2
111 0.2
112 0.18
113 0.14
114 0.1
115 0.1
116 0.11
117 0.1
118 0.11
119 0.09
120 0.09
121 0.1
122 0.16
123 0.17
124 0.18
125 0.18
126 0.17
127 0.18
128 0.22
129 0.22
130 0.19
131 0.19
132 0.18
133 0.18
134 0.18
135 0.19
136 0.15
137 0.14
138 0.15
139 0.18
140 0.17
141 0.18
142 0.19
143 0.17
144 0.18
145 0.19
146 0.21
147 0.19
148 0.2
149 0.22
150 0.21
151 0.2
152 0.19
153 0.16
154 0.11
155 0.11
156 0.12
157 0.12
158 0.12
159 0.14
160 0.14
161 0.14
162 0.15
163 0.12
164 0.11
165 0.09
166 0.1
167 0.09
168 0.09
169 0.09
170 0.1
171 0.11
172 0.1
173 0.1
174 0.09
175 0.08
176 0.08
177 0.09
178 0.08
179 0.08
180 0.08
181 0.08
182 0.1
183 0.1
184 0.1
185 0.1
186 0.11
187 0.12
188 0.15
189 0.18
190 0.16
191 0.16
192 0.16
193 0.16
194 0.16
195 0.15
196 0.12
197 0.1
198 0.09
199 0.09
200 0.09
201 0.09
202 0.09
203 0.09
204 0.11
205 0.18
206 0.21
207 0.22
208 0.26
209 0.26
210 0.27
211 0.3
212 0.29
213 0.22
214 0.21
215 0.19
216 0.15
217 0.14
218 0.13
219 0.1
220 0.09
221 0.08
222 0.08
223 0.08
224 0.08
225 0.08
226 0.08
227 0.12
228 0.13
229 0.14
230 0.13
231 0.14
232 0.13
233 0.14
234 0.16
235 0.12
236 0.14
237 0.18
238 0.2
239 0.2
240 0.22
241 0.23
242 0.19
243 0.19
244 0.18
245 0.15
246 0.16
247 0.2
248 0.24
249 0.27
250 0.29
251 0.32
252 0.4
253 0.43
254 0.43
255 0.46
256 0.48
257 0.48
258 0.47
259 0.46
260 0.39
261 0.34
262 0.32
263 0.27
264 0.22
265 0.23
266 0.29
267 0.33
268 0.36
269 0.41
270 0.46
271 0.52
272 0.55
273 0.57
274 0.56
275 0.57
276 0.6
277 0.61
278 0.6
279 0.6
280 0.6
281 0.6
282 0.6
283 0.6
284 0.6
285 0.6
286 0.6
287 0.6
288 0.6
289 0.6
290 0.6
291 0.6
292 0.6
293 0.6
294 0.6
295 0.6
296 0.6
297 0.6
298 0.6
299 0.6
300 0.6
301 0.6
302 0.6
303 0.6
304 0.6
305 0.6
306 0.6
307 0.6
308 0.59
309 0.57
310 0.54
311 0.5
312 0.48
313 0.47
314 0.46
315 0.44
316 0.44
317 0.47
318 0.47
319 0.46
320 0.46
321 0.45
322 0.44
323 0.43
324 0.4
325 0.39
326 0.42
327 0.44
328 0.42
329 0.43
330 0.41
331 0.41
332 0.4
333 0.39
334 0.34
335 0.31
336 0.33
337 0.32
338 0.31
339 0.28
340 0.27
341 0.25
342 0.26
343 0.25
344 0.2
345 0.16
346 0.17
347 0.18
348 0.17
349 0.14
350 0.12
351 0.14
352 0.15
353 0.15
354 0.11
355 0.1
356 0.14
357 0.18
358 0.18
359 0.16
360 0.15
361 0.19
362 0.25
363 0.25
364 0.21
365 0.18
366 0.18
367 0.22
368 0.22
369 0.2
370 0.14
371 0.14
372 0.19
373 0.21
374 0.22
375 0.18
376 0.22
377 0.25
378 0.26
379 0.25
380 0.2
381 0.21
382 0.21
383 0.22
384 0.19
385 0.15
386 0.15
387 0.14
388 0.15
389 0.1
390 0.08
391 0.09
392 0.07
393 0.06
394 0.05
395 0.05
396 0.05
397 0.04
398 0.04
399 0.02
400 0.03
401 0.02
402 0.03
403 0.04
404 0.04
405 0.04
406 0.05
407 0.06
408 0.06
409 0.06
410 0.07
411 0.07
412 0.08
413 0.08
414 0.09
415 0.1
416 0.1
417 0.1
418 0.1
419 0.09
420 0.07
421 0.07
422 0.06
423 0.05
424 0.05
425 0.05
426 0.05
427 0.07
428 0.07
429 0.07
430 0.07
431 0.07
432 0.07
433 0.07
434 0.07
435 0.06
436 0.06
437 0.06
438 0.06
439 0.05
440 0.05
441 0.06
442 0.06
443 0.06
444 0.06
445 0.06
446 0.05
447 0.05
448 0.05
449 0.06
450 0.06
451 0.07
452 0.07
453 0.07
454 0.07
455 0.08
456 0.1
457 0.1
458 0.11
459 0.11
460 0.1
461 0.1
462 0.1
463 0.09
464 0.07
465 0.06
466 0.05
467 0.05
468 0.04
469 0.04
470 0.03
471 0.02
472 0.02
473 0.02
474 0.02
475 0.02
476 0.01
477 0.01
478 0.01
479 0.01
480 0.01
481 0.02
482 0.02
483 0.03
484 0.04
485 0.06
486 0.13
487 0.15
488 0.2
489 0.3
490 0.41
491 0.51
492 0.61
493 0.69
494 0.72
495 0.81
496 0.8
497 0.74
498 0.66
499 0.63
500 0.62
501 0.59
502 0.53
503 0.43
504 0.39
505 0.38
506 0.37
507 0.32
508 0.3
509 0.31
510 0.31
511 0.37
512 0.42
513 0.42
514 0.42
515 0.42
516 0.4
517 0.4
518 0.45
519 0.43
520 0.45
521 0.44
522 0.45
523 0.49
524 0.5
525 0.44
526 0.37
527 0.35
528 0.29
529 0.28
530 0.25
531 0.19
532 0.14
533 0.13
534 0.1
535 0.09
536 0.1
537 0.1
538 0.1
539 0.09
540 0.07
541 0.08
542 0.08
543 0.08
544 0.06
545 0.09
546 0.11
547 0.13
548 0.13
549 0.13
550 0.14
551 0.15
552 0.16
553 0.13
554 0.11
555 0.1
556 0.1
557 0.1
558 0.08
559 0.09
560 0.09
561 0.1
562 0.1
563 0.12
564 0.12
565 0.12
566 0.13
567 0.13
568 0.13
569 0.15
570 0.15
571 0.12
572 0.13
573 0.12
574 0.14
575 0.13
576 0.13
577 0.12
578 0.11
579 0.12
580 0.13
581 0.14
582 0.11
583 0.17
584 0.17
585 0.17
586 0.19
587 0.21
588 0.2
589 0.2
590 0.2
591 0.15
592 0.15
593 0.14
594 0.12
595 0.12
596 0.13
597 0.13
598 0.14
599 0.14
600 0.14
601 0.14
602 0.16
603 0.15
604 0.15
605 0.16
606 0.16
607 0.16
608 0.16
609 0.14
610 0.13
611 0.13
612 0.12
613 0.1
614 0.09
615 0.09
616 0.09
617 0.1
618 0.12
619 0.11
620 0.13
621 0.16
622 0.17
623 0.19
624 0.25
625 0.26
626 0.33
627 0.39
628 0.38
629 0.38
630 0.4
631 0.41
632 0.37
633 0.37
634 0.29
635 0.28
636 0.29
637 0.26
638 0.24
639 0.21
640 0.22
641 0.21
642 0.26
643 0.24
644 0.22
645 0.25
646 0.32
647 0.38
648 0.44
649 0.45
650 0.45
651 0.51
652 0.54
653 0.54
654 0.48
655 0.39
656 0.33
657 0.29
658 0.24
659 0.17
660 0.13
661 0.1
662 0.08
663 0.07
664 0.07
665 0.07
666 0.06
667 0.05
668 0.05
669 0.06
670 0.07
671 0.07
672 0.09