Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AQN1

Protein Details
Accession A0A139AQN1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKRRAKRKAPTRTKVVLDRBasic
NLS Segment(s)
PositionSequence
3-11KRRAKRKAP
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRRAKRKAPTRTKVVLDREFNCPFCNHEKSIDIKLDRPNKVATLTCRTCGVGWQTKITSLDENTDVYHKWIDSIEEINRDVAPEGVAGGAGRYAPARNARAVADDGRSDEEADD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.76
4 0.73
5 0.69
6 0.63
7 0.61
8 0.58
9 0.52
10 0.45
11 0.37
12 0.33
13 0.34
14 0.36
15 0.3
16 0.29
17 0.31
18 0.33
19 0.38
20 0.39
21 0.34
22 0.33
23 0.4
24 0.45
25 0.43
26 0.42
27 0.38
28 0.33
29 0.34
30 0.33
31 0.29
32 0.3
33 0.3
34 0.28
35 0.28
36 0.27
37 0.25
38 0.24
39 0.25
40 0.23
41 0.22
42 0.24
43 0.23
44 0.24
45 0.25
46 0.23
47 0.19
48 0.13
49 0.14
50 0.13
51 0.13
52 0.12
53 0.12
54 0.11
55 0.11
56 0.11
57 0.09
58 0.09
59 0.09
60 0.09
61 0.1
62 0.13
63 0.14
64 0.15
65 0.16
66 0.16
67 0.16
68 0.15
69 0.14
70 0.11
71 0.09
72 0.06
73 0.06
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.06
83 0.1
84 0.16
85 0.19
86 0.2
87 0.22
88 0.23
89 0.25
90 0.28
91 0.26
92 0.23
93 0.22
94 0.23
95 0.24
96 0.24