Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A138ZYL5

Protein Details
Accession A0A138ZYL5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
20-43VRESHEARSKEKRQRRGHQSELATHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010997  HRDC-like_sf  
IPR006590  RNA_pol_Rpb4/RPC9_core  
IPR005574  Rpb4/RPC9  
IPR038324  Rpb4/RPC9_sf  
IPR038846  RPC9  
Gene Ontology GO:0005666  C:RNA polymerase III complex  
GO:0000166  F:nucleotide binding  
GO:0006384  P:transcription initiation at RNA polymerase III promoter  
Pfam View protein in Pfam  
PF03874  RNA_pol_Rpb4  
Amino Acid Sequences MEVVDEQSARLCDSEVLALVRESHEARSKEKRQRRGHQSELATVEHQLISYFKELDLPSTHQTPAHVQALQVALKPYNLKRNELLQIVNTRPTLPVELAIVLSNPDSHEHHLEDMLAAIGEALPVPPKRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.11
5 0.11
6 0.11
7 0.12
8 0.13
9 0.13
10 0.15
11 0.22
12 0.23
13 0.29
14 0.38
15 0.47
16 0.55
17 0.63
18 0.69
19 0.72
20 0.81
21 0.86
22 0.85
23 0.83
24 0.81
25 0.74
26 0.69
27 0.62
28 0.53
29 0.42
30 0.33
31 0.26
32 0.18
33 0.15
34 0.11
35 0.08
36 0.08
37 0.09
38 0.09
39 0.07
40 0.12
41 0.11
42 0.13
43 0.15
44 0.17
45 0.18
46 0.19
47 0.2
48 0.16
49 0.17
50 0.17
51 0.18
52 0.17
53 0.15
54 0.13
55 0.15
56 0.17
57 0.16
58 0.15
59 0.12
60 0.1
61 0.11
62 0.14
63 0.14
64 0.21
65 0.22
66 0.24
67 0.25
68 0.29
69 0.32
70 0.31
71 0.3
72 0.25
73 0.28
74 0.27
75 0.29
76 0.24
77 0.21
78 0.2
79 0.2
80 0.19
81 0.14
82 0.13
83 0.11
84 0.11
85 0.11
86 0.11
87 0.09
88 0.08
89 0.08
90 0.07
91 0.07
92 0.09
93 0.11
94 0.15
95 0.18
96 0.19
97 0.2
98 0.2
99 0.2
100 0.17
101 0.15
102 0.12
103 0.08
104 0.06
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.09